KEGG   Homo sapiens (human): 5277Help
Entry
5277              CDS       T01001                                 

Gene name
PIGA, GPI3, MCAHS2, PIG-A
Definition
phosphatidylinositol glycan anchor biosynthesis, class A (EC:2.4.1.198)
Orthology
K03857  
phosphatidylinositol glycan, class A [EC:2.4.1.198]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
Metabolic pathways
Module
GPI-anchor biosynthesis, core oligosaccharide
Disease
H01053  
Paroxysmal nocturnal hemoglobinuria (PNH)
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosylphosphatidylinositol(GPI)-anchor biosynthesis [PATH:hsa00563]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xp22.1
AA seq 484 aa AA seqDB search
MACRGGAGNGHRASATLSRVSPGSLYTCRTRTHNICMVSDFFYPNMGGVESHIYQLSQCL
IERGHKVIIVTHAYGNRKGIRYLTSGLKVYYLPLKVMYNQSTATTLFHSLPLLRYIFVRE
RVTIIHSHSSFSAMAHDALFHAKTMGLQTVFTDHSLFGFADVSSVLTNKLLTVSLCDTNH
IICVSYTSKENTVLRAALNPEIVSVIPNAVDPTDFTPDPFRRHDSITIVVVSRLVYRKGI
DLLSGIIPELCQKYPDLNFIIGGEGPKRIILEEVRERYQLHDRVRLLGALEHKDVRNVLV
QGHIFLNTSLTEAFCMAIVEAASCGLQVVSTRVGGIPEVLPENLIILCEPSVKSLCEGLE
KAIFQLKSGTLPAPENIHNIVKTFYTWRNVAERTEKVYDRVSVEAVLPMDKRLDRLISHC
GPVTGYIFALLAVFNFLFLIFLRWMTPDSIIDVAIDATGPRGAWTNNYSHSKRGGENNEI
SETR
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggcctgtagaggaggagctgggaatggccaccgtgcctcagctacactctctcgggtt
agccctggaagtctttacacatgtagaacccgtacccataatatatgcatggtatctgac
tttttctacccaaatatgggaggcgtggaaagccacatttaccagctctctcagtgcctg
attgaaagagggcataaggttataattgtcacccatgcttatggaaatcgaaaaggcatc
cgttacctcaccagtggcctcaaagtctattacttgcctctgaaagtcatgtacaaccag
tctacagccacgaccctctttcacagtctgccattgctcaggtacatatttgttcgggag
agagtcacgataatccattcacatagttctttttctgctatggcccatgatgctctcttc
cacgccaagacaatggggcttcagacagtcttcacggaccattccctttttggatttgct
gatgtcagctcggtgcttacaaacaagcttctaaccgtgtctctttgtgatacaaaccac
atcatttgtgtgtcttatactagtaaggaaaatactgtactaagagcagcactgaatcct
gaaatagtgtccgtcattcctaatgctgtagatcctactgacttcactccagacccattt
agaaggcatgatagtataactattgttgttgtcagcagacttgtttacagaaaagggatc
gatttgcttagtggtataatacctgaactctgtcagaaatatccagatttaaatttcata
attggaggagagggaccaaagagaatcattttggaagaagttcgggaaagataccagctg
catgacagggtgcgtcttttgggagctttagaacacaaggatgttagaaatgtcttagtt
caaggacatatttttctgaatacctcccttactgaagcattctgcatggcgatcgtggaa
gcagccagttgtggtttacaggttgtaagtaccagagttggtggaattcctgaggtgctt
ccagaaaaccttattattttatgtgagccttcagtaaaatctttgtgtgaaggattggaa
aaggctattttccaactgaagtcagggacattgccagctccagaaaacatccataacata
gtaaagactttctacacctggaggaatgttgcagaaagaactgaaaaggtatatgaccgg
gtatcagtggaagctgtgttgccaatggacaaacgactggacagacttatttctcactgc
ggcccagtaacaggctacatctttgctttgttggcagttttcaacttcctcttcctcatt
ttcttgagatggatgactccagattctatcattgatgttgcaatagatgccactgggcca
cggggtgcctggactaataactattctcacagtaaaagagggggtgagaataatgagata
tctgaaaccaggtag

DBGET integrated database retrieval system