KEGG   Homo sapiens (human): 5360Help
Entry
5360              CDS       T01001                                 

Gene name
PLTP, BPIFE, HDLCQ9
Definition
phospholipid transfer protein
Orthology
K08761  
phospholipid transfer protein
Organism
hsa  Homo sapiens (human)
Pathway
PPAR signaling pathway
Class
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:hsa03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20q13.12
AA seq 398 aa AA seqDB search
MALFGALFLALLAGAHAEFPGCKIRVTSKALELVKQEGLRFLEQELETITIPDLRGKEGH
FYYNISEKVYDFLSTFITSGMRFLLNQQICPVLYHAGTVLLNSLLDTVPVRSSVDELVGI
DYSLMKDPVASTSNLDMDFRGAFFPLTERNWSLPNRAVEPQLQEEERMVYVAFSEFFFDS
AMESYFRAGALQLLLVGDKVPHDLDMLLRATYFGSIVLLSPAVIDSPLKLELRVLAPPRC
TIKPSGTTISVTASVTIALVPPDQPEVQLSSMTMDARLSAKMALRGKALRTQLDLRRFRI
YSNHSALESLALIPLQAPLKTMLQIGVMPMLNERTWRGVQIPLPEGINFVHEVVTNHAGF
LTIGADLHFAKGLREVIEKNRPADVRASTAPTPSTAAV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggccctcttcggggccctcttcctagcgctgctggcaggcgcacatgcagagttccca
ggctgcaagatccgcgtcacctccaaggcgctggagctggtgaagcaggaggggctgcgc
tttctggagcaagagctggagactatcaccattccggacctgcggggcaaagaaggccac
ttctactacaacatctctgagaaggtgtatgattttctctccacgttcatcacctcaggg
atgcgcttcctcctcaaccagcagatctgccctgtcctctaccacgcagggacggtcctg
ctcaactccctcctggacaccgtgcctgtgcgcagttctgtggacgagcttgttggcatt
gactattccctcatgaaggatcctgtggcttccaccagcaacctggacatggacttccgg
ggggccttcttccccctgactgagaggaactggagcctccccaaccgggcagtggagccc
cagctgcaggaggaagagcggatggtgtatgtggccttctctgagttcttcttcgactct
gccatggagagctacttccgggcgggggccctgcagctgttgctggtgggggacaaggtg
ccccacgacctggacatgctgctgagggccacctactttgggagcattgtcctgctgagc
ccagcagtgattgactccccattgaagctggagctgcgggtcctggccccaccgcgctgc
accatcaagccctctggcaccaccatctctgtcactgctagcgtcaccattgccctggtc
ccaccagaccagcctgaggtccagctgtccagcatgactatggacgcccgtctcagcgcc
aagatggctctccgggggaaggccctgcgcacgcagctggacctgcgcaggttccgaatc
tattccaaccattctgcactggagtcgctggctctgatcccattacaggcccctctgaag
accatgctgcagattggggtgatgcccatgctcaatgagcggacctggcgtggggtgcag
atcccactacctgagggcatcaactttgtgcatgaggtggtgacgaaccatgcgggattc
ctcaccatcggggctgatctccactttgccaaagggctgcgagaggtgattgagaagaac
cggcctgctgatgtcagggcgtccactgcccccacaccgtccacagcagctgtctga

DBGET integrated database retrieval system