KEGG   Homo sapiens (human): 54145Help
Entry
54145             CDS       T01001                                 

Gene name
H2BFS, H2B/s
Definition
(RefSeq) H2B histone family member S
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa
Motif
Other DBs
NCBI-GeneID: 54145
NCBI-ProteinID: NP_059141
HGNC: 4762
Position
21q22.3
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGRKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLPHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSAK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgccggagccagcgaagtccgctcccgcgcccaagaagggctcgaagaaagccgtgact
aaggcgcagaagaaggacggcaggaagcgcaagcgcagccgcaaggagagctactccgta
tacgtgtacaaggtgctgaagcaggtccaccccgacaccggcatctcctctaaggccatg
ggaatcatgaactccttcgtcaacgacatcttcgaacgcatcgcaggtgaggcttcccgc
ctgccgcattacaacaagcgctcgaccatcacctccagggagatccagacggccgtgcgc
ctgctgctgcccggggagttggccaagcacgccgtgtccgagggcaccaaggccgtcacc
aagtacaccagcgctaagtaa

DBGET integrated database retrieval system