KEGG   Homo sapiens (human): 5429Help
Entry
5429              CDS       T01001                                 

Gene name
POLH, RAD30, RAD30A, XP-V, XPV
Definition
polymerase (DNA directed), eta (EC:2.7.7.7)
Orthology
K03509  
DNA polymerase eta [EC:2.7.7.7]
Organism
hsa  Homo sapiens (human)
Pathway
Fanconi anemia pathway
Disease
H00403  
Disorders of nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    5429 (POLH)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     5429 (POLH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.1
AA seq 713 aa AA seqDB search
MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVT
RSMWADDAKKLCPDLLLAQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVD
LTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEETVQKEGMRKQGLFQWLDSLQI
DNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSH
GSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYA
MCRGIEHDPVKPRQLPKTIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDND
RVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAFTVIKNCNTSGIQTEWSPPLT
MLFLCATKFSASAPSSSTDITSFLSSDPSSLPKVPVTSSEAKTQGSGPAVTATKKATTSL
ESFFQKAAERQKVKEASLSSLTAPTQAPMSNSPSKPSLPFQTSQSTGTEPFFKQKSLLLK
QKQLNNSSVSSPQQNPWSNCKALPNSLPTEYPGCVPVCEGVSKLEESSKATPAEMDLAHN
SQSMHASSASKSVLEVTQKATPNPSLLAAEDQVPCEKCGSLVPVWDMPEHMDYHFALELQ
KSFLQPHSSNPQVVSAVSHQGKRNPKSPLACTNKRPRPEGMQTLESFFKPLTH
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atggctactggacaggatcgagtggttgctctcgtggacatggactgtttttttgttcaa
gtggagcagcggcaaaatcctcatttgaggaataaaccttgtgcagttgtacagtacaaa
tcatggaagggtggtggaataattgcagtgagttatgaagctcgtgcatttggagtcact
agaagtatgtgggcagatgatgctaagaagttatgtccagatcttctactggcacaagtt
cgtgagtcccgtgggaaagctaacctcaccaagtaccgggaagccagtgttgaagtgatg
gagataatgtctcgttttgctgtgattgaacgtgccagcattgatgaggcttacgtagat
ctgaccagtgctgtacaagagagactacaaaagctacaaggtcagcctatctcggcagac
ttgttgccaagcacttacattgaagggttgccccaaggccctacaacggcagaagagact
gttcagaaagaggggatgcgaaaacaaggcttatttcaatggctcgattctcttcagatt
gataacctcacctctccagacctgcagctcaccgtgggagcagtgattgtggaggaaatg
agagcagccatagagagggagactggttttcagtgttcagctggaatttcacacaataag
gtcctggcaaaactggcctgtggactaaacaagcccaaccgccaaaccctggtttcacat
gggtcagtcccacagctcttcagccaaatgcccattcgcaaaatccgtagtcttggagga
aagctaggggcctctgtcattgagatcctagggatagaatacatgggtgaactgacccag
ttcactgaatcccagctccagagtcattttggggagaagaatgggtcttggctatatgcc
atgtgccgagggattgaacatgatccagttaaacccaggcaactacccaaaaccattggc
tgtagtaagaacttcccaggaaaaacagctcttgctactcgggaacaggtacaatggtgg
ctgttgcaattagcccaggaactagaggagagactgactaaagaccgaaatgataatgac
agggtagccacccagctggttgtgagcattcgtgtacaaggagacaaacgcctcagcagc
ctgcgccgctgctgtgcccttacccgctatgatgctcacaagatgagccatgatgcattt
actgtcatcaagaactgtaatacttctggaatccagacagaatggtctcctcctctcaca
atgcttttcctctgtgctacaaaattttctgcctctgccccttcatcttctacagacatc
accagcttcttgagcagtgacccaagttctctgccaaaggtgccagttaccagctcagaa
gctaagacccagggaagtggcccagcggtgacagccactaagaaagcaaccacgtctctg
gaatcattcttccaaaaagctgcagaaaggcagaaagttaaagaagcttcgctttcatct
cttactgctcccactcaggctcccatgagcaattcaccatccaagccctcattacctttt
caaaccagtcaaagtacaggaactgagcccttctttaagcagaaaagtctgcttctaaag
cagaaacagcttaataattcttcagtttcttccccccaacaaaacccatggtccaactgt
aaagcattaccaaactctttaccaacagagtatccagggtgtgtccctgtttgtgaaggg
gtgtcgaagctagaagaatcctctaaagcaactcctgcagagatggatttggcccacaac
agccaaagcatgcacgcctcttcagcttccaaatctgtgctggaggtgactcagaaagca
accccaaatccaagtcttctagctgctgaggaccaagtgccctgtgagaagtgtggctcc
ctggtaccggtatgggatatgccagaacacatggactatcattttgcattggagttgcag
aaatcctttttgcagccccactcttcaaacccccaggttgtttctgccgtatctcatcaa
ggcaaaagaaatcccaagagccctttggcctgcactaataaacgccccaggcctgagggc
atgcaaacattggaatcattttttaagccattaacacattag

DBGET integrated database retrieval system