KEGG   Homo sapiens (human): 54556Help
Entry
54556             CDS       T01001                                 

Gene name
ING3, Eaf4, ING2, MEAF4, p47ING3
Definition
(RefSeq) inhibitor of growth family member 3
  KO
K11319  inhibitor of growth protein 3
Organism
hsa  Homo sapiens (human)
Brite
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     54556 (ING3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ING PHD SAICAR_synt zf-HC5HC2H Pet100 PHD_2 DUF3829
Motif
Other DBs
NCBI-GeneID: 54556
NCBI-ProteinID: NP_061944
OMIM: 607493
HGNC: 14587
Ensembl: ENSG00000071243
Vega: OTTHUMG00000141270
Pharos: Q9NXR8(Tbio)
UniProt: Q9NXR8
Structure
PDB: 

Jmol
Position
7q31.31
AA seq 418 aa AA seqDB search
MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREE
QMASIKKDYYKALEDADEKVQLANQIYDLVDRHLRKLDQELAKFKMELEADNAGITEILE
RRSLELDTPSQPVNNHHAHSHTPVEKRKYNPTSHHTTTDHIPEKKFKSEALLSTLTSDAS
KENTLGCRNNNSTASSNNAYNVNSSQPLGSYNIGSLSSGTGAGAITMAAAQAVQATAQMK
EGRRTSSLKASYEAFKNNDFQLGKEFSMARETVGYSSSSALMTTLTQNASSSAADSRSGR
KSKNNNKSSSQQSSSSSSSSSLSSCSSSSTVVQEISQQTTVVPESDSNSQVDWTYDPNEP
RYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWYCPQCTAAMKRRGSRHK
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgttgtacctagaagactatctggaaatgattgagcagcttcctatggatctgcgggac
cgcttcacggaaatgcgcgagatggacctgcaggtgcagaatgcaatggatcaactagaa
caaagagtcagtgaattctttatgaatgcaaagaaaaataaacctgagtggagggaagag
caaatggcatccatcaaaaaagactactataaagctttggaagatgcagatgagaaggtt
cagttggcaaaccagatatatgacttggtagatcgacacttgagaaagctggatcaggaa
ctggctaagtttaaaatggagctggaagctgataatgctggaattacagaaatattagag
aggcgatctttggaattagacactccttcacagccagtgaacaatcaccatgctcattca
catactccagtggaaaaaaggaaatataatccaacttctcaccatacgacaacagatcat
attcctgaaaagaaatttaaatctgaagctcttctatccacccttacgtcagatgcctct
aaggaaaatacactaggttgtcgaaataataattccacagcctcttctaacaatgcctac
aatgtgaattcctcccaacctctgggatcctataacattggctcgttatcttcaggaact
ggtgcaggggcaattaccatggcagctgctcaagcagttcaggctacagctcagatgaag
gagggacgaagaacatcaagtttaaaagccagttatgaagcatttaagaataatgacttt
cagttgggaaaagaattttcaatggccagggaaacagttggctattcatcatcttcggca
cttatgacaacattaacacagaatgccagttcatcagcagccgactcacggagtggtcga
aagagcaaaaacaacaacaagtcttcaagccagcagtcatcatcttcctcctcctcttct
tccttatcatcgtgttcttcatcatcaactgttgtacaagaaatctctcaacaaacaact
gtagtgccagaatctgattcaaatagtcaggttgattggacttacgacccaaatgaacct
cgatactgcatttgtaatcaggtatcttatggtgagatggtgggatgtgataaccaagat
tgccctatagaatggttccattatggctgcgttggattgacagaggcaccaaaaggcaaa
tggtactgtccacagtgcactgctgcaatgaagagaagaggcagcagacacaaataa

DBGET integrated database retrieval system