KEGG   Homo sapiens (human): 54556Help
Entry
54556             CDS       T01001                                 

Gene name
ING3, Eaf4, ING2, MEAF4, p47ING3
Definition
inhibitor of growth family, member 3
Orthology
K11319  
inhibitor of growth protein 3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q31
AA seq 418 aa AA seqDB search
MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREE
QMASIKKDYYKALEDADEKVQLANQIYDLVDRHLRKLDQELAKFKMELEADNAGITEILE
RRSLELDTPSQPVNNHHAHSHTPVEKRKYNPTSHHTTTDHIPEKKFKSEALLSTLTSDAS
KENTLGCRNNNSTASSNNAYNVNSSQPLGSYNIGSLSSGTGAGAITMAAAQAVQATAQMK
EGRRTSSLKASYEAFKNNDFQLGKEFSMARETVGYSSSSALMTTLTQNASSSAADSRSGR
KSKNNNKSSSQQSSSSSSSSSLSSCSSSSTVVQEISQQTTVVPESDSNSQVDWTYDPNEP
RYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGKWYCPQCTAAMKRRGSRHK
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgttgtacctagaagactatctggaaatgattgagcagcttcctatggatctgcgggac
cgcttcacggaaatgcgcgagatggacctgcaggtgcagaatgcaatggatcaactagaa
caaagagtcagtgaattctttatgaatgcaaagaaaaataaacctgagtggagggaagag
caaatggcatccatcaaaaaagactactataaagctttggaagatgcagatgagaaggtt
cagttggcaaaccagatatatgacttggtagatcgacacttgagaaagctggatcaggaa
ctggctaagtttaaaatggagctggaagctgataatgctggaattacagaaatattagag
aggcgatctttggaattagacactccttcacagccagtgaacaatcaccatgctcattca
catactccagtggaaaaaaggaaatataatccaacttctcaccatacgacaacagatcat
attcctgaaaagaaatttaaatctgaagctcttctatccacccttacgtcagatgcctct
aaggaaaatacactaggttgtcgaaataataattccacagcctcttctaacaatgcctac
aatgtgaattcctcccaacctctgggatcctataacattggctcgttatcttcaggaact
ggtgcaggggcaattaccatggcagctgctcaagcagttcaggctacagctcagatgaag
gagggacgaagaacatcaagtttaaaagccagttatgaagcatttaagaataatgacttt
cagttgggaaaagaattttcaatggccagggaaacagttggctattcatcatcttcggca
cttatgacaacattaacacagaatgccagttcatcagcagccgactcacggagtggtcga
aagagcaaaaacaacaacaagtcttcaagccagcagtcatcatcttcctcctcctcttct
tccttatcatcgtgttcttcatcatcaactgttgtacaagaaatctctcaacaaacaact
gtagtgccagaatctgattcaaatagtcaggttgattggacttacgacccaaatgaacct
cgatactgcatttgtaatcaggtatcttatggtgagatggtgggatgtgataaccaagat
tgccctatagaatggttccattatggctgcgttggattgacagaggcaccaaaaggcaaa
tggtactgtccacagtgcactgctgcaatgaagagaagaggcagcagacacaaataa

DBGET integrated database retrieval system