KEGG   Homo sapiens (human): 55037Help
Entry
55037             CDS       T01001                                 

Gene name
PTCD3, MRP-S39
Definition
(RefSeq) pentatricopeptide repeat domain 3
  KO
K17659  pentatricopeptide repeat domain-containing protein 3
Organism
hsa  Homo sapiens (human)
Brite
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    55037 (PTCD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PPR_2 PPR_3 PPR_long PPR RPM2 FANCI_S2
Motif
Other DBs
NCBI-GeneID: 55037
NCBI-ProteinID: NP_060422
OMIM: 614918
HGNC: 24717
Ensembl: ENSG00000132300
Vega: OTTHUMG00000153168
Pharos: Q96EY7(Tbio)
UniProt: Q96EY7
Position
2p11.2
AA seq 689 aa AA seqDB search
MAVVSAVRWLGLRSRLGQPLTGRRAGLCEQARSCRFYSGSATLSKVEGTDVTGIEEVVIP
KKKTWDKVAVLQALASTVNRDTTAVPYVFQDDPYLMPASSLESRSFLLAKKSGENVAKFI
INSYPKYFQKDIAEPHIPCLMPEYFEPQIKDISEAALKERIELRKVKASVDMFDQLLQAG
TTVSLETTNSLLDLLCYYGDQEPSTDYHFQQTGQSEALEEENDETSRRKAGHQFGVTWRA
KNNAERIFSLMPEKNEHSYCTMIRGMVKHRAYEQALNLYTELLNNRLHADVYTFNALIEA
TVCAINEKFEEKWSKILELLRHMVAQKVKPNLQTFNTILKCLRRFHVFARSPALQVLREM
KAIGIEPSLATYHHIIRLFDQPGDPLKRSSFIIYDIMNELMGKRFSPKDPDDDKFFQSAM
SICSSLRDLELAYQVHGLLKTGDNWKFIGPDQHRNFYYSKFFDLICLMEQIDVTLKWYED
LIPSAYFPHSQTMIHLLQALDVANRLEVIPKIWKDSKEYGHTFRSDLREEILMLMARDKH
PPELQVAFADCAADIKSAYESQPIRQTAQDWPATSLNCIAILFLRAGRTQEAWKMLGLFR
KHNKIPRSELLNELMDSAKVSNSPSQAIEVVELASAFSLPICEGLTQRVMSDFAINQEQK
EALSNLTALTSDSDTDSSSDSDSDTSEGK
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggcggttgtatctgctgttcgctggctgggcctccgcagcaggcttggccagccgctg
acgggtcggcgggcgggtttgtgtgaacaggcacgcagctgcagattttattctggtagt
gcaaccctctcaaaggttgaaggaactgatgtaacagggattgaagaagtagtaattcca
aaaaagaaaacttgggataaagtagccgttcttcaggcacttgcatccacagtaaacagg
gataccacagctgtgccttatgtgtttcaagatgatccttaccttatgccagcatcatct
ttggaatctcgttcatttttactggcaaagaaatccggggagaatgtggccaagtttatt
attaattcataccccaaatattttcagaaggacatagctgaacctcatataccgtgttta
atgcctgagtactttgaacctcagatcaaagacataagtgaagccgccctgaaggaacga
attgagctcagaaaagtcaaagcctctgtggacatgtttgatcagcttttgcaagcagga
accactgtgtctcttgaaacaacaaatagtctcttggatttattgtgttactatggtgac
caggagccctcaactgattaccattttcaacaaactggacagtcagaagcattggaagag
gaaaatgatgagacatctaggaggaaagctggtcatcagtttggagttacatggcgagca
aaaaacaacgctgagagaatcttttctctaatgccagagaaaaatgaacattcctattgc
acaatgatccgaggaatggtgaagcaccgagcttatgagcaggcattaaacttgtacact
gagttactaaacaacagactccatgctgatgtatacacatttaatgcattgattgaagca
acagtatgtgcgataaatgagaaatttgaggaaaaatggagtaaaatactggagctgcta
agacacatggttgcacagaaggtgaaaccaaatcttcagacttttaataccattctgaaa
tgtctccgaagatttcatgtgtttgcaagatcgccagccttacaggttttacgtgaaatg
aaagccattggaatagaaccctcgcttgcaacatatcaccatattattcgcctgtttgat
caacctggagaccctttaaagagatcatccttcatcatttatgatataatgaatgaatta
atgggaaagagattttctccaaaggacccggatgatgataagttttttcagtcagccatg
agcatatgctcatctctcagagatctagaacttgcctaccaagtacatggccttttaaaa
accggagacaactggaaattcattggacctgatcaacatcgtaatttctattattccaag
ttcttcgatttgatttgtctaatggaacaaattgatgttaccttgaagtggtatgaggac
ctgataccttcagcctactttccccactcccaaacaatgatacatcttctccaagcattg
gatgtggccaatcggctagaagtgattcctaaaatttggaaagatagtaaagaatatggt
catactttccgcagtgacctgagagaagagatcctgatgctcatggcaagggacaagcac
ccaccagagcttcaggtggcatttgctgactgtgctgctgatatcaaatctgcgtatgaa
agccaacccatcagacagactgctcaggattggccagccacctctctcaactgtatagct
atcctctttttaagggctgggagaactcaggaagcctggaaaatgttggggcttttcagg
aagcataataagattcctagaagtgagttgctgaatgagcttatggacagtgcaaaagtg
tctaacagcccttcccaggccattgaagtagtagagctggcaagtgccttcagcttacct
atttgtgagggcctcacccagagagtaatgagtgattttgcaatcaaccaggaacaaaag
gaagccctaagtaatctaactgcattgaccagtgacagtgatactgacagcagcagtgac
agcgacagtgacaccagtgaaggcaaatga

DBGET integrated database retrieval system