KEGG   Homo sapiens (human): 5540Help
Entry
5540              CDS       T01001                                 

Gene name
NPY4R, NPY4-R, PP1, PPYR1, Y4
Definition
(RefSeq) neuropeptide Y receptor Y4
  KO
K04206  neuropeptide Y receptor type 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5540 (NPY4R)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Neuropeptide
   Neuropeptide Y [OT]
    5540 (NPY4R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx DUF4790 Piezo_RRas_bdg PsbW
Motif
Other DBs
NCBI-GeneID: 5540
NCBI-ProteinID: NP_001265723
OMIM: 601790
HGNC: 9329
Ensembl: ENSG00000204174
Vega: OTTHUMG00000018108
Pharos: P50391(Tchem)
UniProt: P50391
Position
10q11.22
AA seq 375 aa AA seqDB search
MNTSHLLALLLPKSPQGENRSKPLGTPYNFSEHCQDSVDVMVFIVTSYSIETVVGVLGNL
CLMCVTVRQKEKANVTNLLIANLAFSDFLMCLLCQPLTAVYTIMDYWIFGETLCKMSAFI
QCMSVTVSILSLVLVALERHQLIINPTGWKPSISQAYLGIVLIWVIACVLSLPFLANSIL
ENVFHKNHSKALEFLADKVVCTESWPLAHHRTIYTTFLLLFQYCLPLGFILVCYARIYRC
LQRQGRVFHKGTYSLRAGHMKQVNVVLVVMVVAFAVLWLPLHVFNSLEDWHHEAIPICHG
NLIFLVCHLLAMASTCVNPFIYGFLNTNFKKEIKALVLTCQQSAPLEESEHLPLSTVHTE
VSKGSLRLSGRSNPI
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaacacctctcacctcctggccttgctgctcccaaaatctccacaaggtgaaaacaga
agcaaacccctgggcaccccatacaacttctctgaacattgccaggattccgtggacgtg
atggtcttcatcgtcacttcctacagcattgagactgtcgtgggggtcctgggtaacctc
tgcctgatgtgtgtgactgtgaggcagaaggagaaagccaacgtgaccaacctgcttatc
gccaacctggccttctctgacttcctcatgtgcctcctctgccagccgctgaccgccgtc
tacaccatcatggactactggatctttggagagaccctctgcaagatgtcggccttcatc
cagtgcatgtcggtgacggtctccatcctctcgctcgtcctcgtggccctggagaggcat
cagctcatcatcaacccaacaggctggaagcccagcatctcacaggcctacctggggatt
gtgctcatctgggtcattgcctgtgtcctctccctgcccttcctggccaacagcatcctg
gagaatgtcttccacaagaaccactccaaggctctggagttcctggcggataaggtggtc
tgtaccgagtcctggccactggctcaccaccgcaccatctacaccaccttcctgctcctc
ttccagtactgcctcccactgggcttcatcttggtctgttatgcacgcatctaccggtgc
ctgcagaggcaggggcgcgtgtttcacaagggcacctacagcttgcgagctgggcacatg
aagcaggtcaatgtggtgctggtggtgatggtggtggcctttgccgtgctctggctgcct
ctgcatgtgttcaacagcctggaagactggcaccatgaggccatccccatctgccatggg
aacctcatcttcttagtgtgccacttgcttgccatggcctccacctgtgtcaacccattc
atctatggctttctcaacaccaacttcaagaaggagatcaaggccctggtgctgacttgc
cagcagagcgcccccctggaggagtcagagcatctgcccctgtccacagtacatacggaa
gtctccaaagggtccctgaggctaagtggcaggtccaatcccatttaa

DBGET integrated database retrieval system