KEGG   Homo sapiens (human): 5540Help
Entry
5540              CDS       T01001                                 

Gene name
NPY4R, NPY4-R, PP1, PPYR1, Y4
Definition
neuropeptide Y receptor Y4
Orthology
K04204  
neuropeptide Y receptor type 1/4/6
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
10q11.2
AA seq 375 aa AA seqDB search
MNTSHLLALLLPKSPQGENRSKPLGTPYNFSEHCQDSVDVMVFIVTSYSIETVVGVLGNL
CLMCVTVRQKEKANVTNLLIANLAFSDFLMCLLCQPLTAVYTIMDYWIFGETLCKMSAFI
QCMSVTVSILSLVLVALERHQLIINPTGWKPSISQAYLGIVLIWVIACVLSLPFLANSIL
ENVFHKNHSKALEFLADKVVCTESWPLAHHRTIYTTFLLLFQYCLPLGFILVCYARIYRC
LQRQGRVFHKGTYSLRAGHMKQVNVVLVVMVVAFAVLWLPLHVFNSLEDWHHEAIPICHG
NLIFLVCHLLAMASTCVNPFIYGFLNTNFKKEIKALVLTCQQSAPLEESEHLPLSTVHTE
VSKGSLRLSGRSNPI
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaacacctctcacctcctggccttgctgctcccaaaatctccacaaggtgaaaacaga
agcaaacccctgggcaccccatacaacttctctgaacattgccaggattccgtggacgtg
atggtcttcatcgtcacttcctacagcattgagactgtcgtgggggtcctgggtaacctc
tgcctgatgtgtgtgactgtgaggcagaaggagaaagccaacgtgaccaacctgcttatc
gccaacctggccttctctgacttcctcatgtgcctcctctgccagccgctgaccgccgtc
tacaccatcatggactactggatctttggagagaccctctgcaagatgtcggccttcatc
cagtgcatgtcggtgacggtctccatcctctcgctcgtcctcgtggccctggagaggcat
cagctcatcatcaacccaacaggctggaagcccagcatctcacaggcctacctggggatt
gtgctcatctgggtcattgcctgtgtcctctccctgcccttcctggccaacagcatcctg
gagaatgtcttccacaagaaccactccaaggctctggagttcctggcggataaggtggtc
tgtaccgagtcctggccactggctcaccaccgcaccatctacaccaccttcctgctcctc
ttccagtactgcctcccactgggcttcatcttggtctgttatgcacgcatctaccggtgc
ctgcagaggcaggggcgcgtgtttcacaagggcacctacagcttgcgagctgggcacatg
aagcaggtcaatgtggtgctggtggtgatggtggtggcctttgccgtgctctggctgcct
ctgcatgtgttcaacagcctggaagactggcaccatgaggccatccccatctgccatggg
aacctcatcttcttagtgtgccacttgcttgccatggcctccacctgtgtcaacccattc
atctatggctttctcaacaccaacttcaagaaggagatcaaggccctggtgctgacttgc
cagcagagcgcccccctggaggagtcagagcatctgcccctgtccacagtacatacggaa
gtctccaaagggtccctgaggctaagtggcaggtccaatcccatttaa

DBGET integrated database retrieval system