KEGG   Homo sapiens (human): 55630Help
Entry
55630             CDS       T01001                                 

Gene name
SLC39A4, AEZ, AWMS2, ZIP4
Definition
solute carrier family 39 (zinc transporter), member 4
Orthology
K14710  
solute carrier family 39 (zinc transporter), member 4
Organism
hsa  Homo sapiens (human)
Pathway
Mineral absorption
Disease
H00212  
Acrodermatitis enteropathica (AEZ)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04978 Mineral absorption
    55630 (SLC39A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q24.3
AA seq 149 aa AA seqDB search
MITLGDAVHNFADGLAVGAAFASSWKTGLATSLAVFCHELPHELGDFAALLHAGLSVRQA
LLLNLASALTAFAGLYVALAVGVSEESEAWILAVATGLFLYVALCDMLPAMLKVRDPRPW
LLFLLHNVGLLGGWTVLLLLSLYEDDITF
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgatcactctgggcgacgccgtgcacaacttcgccgacgggctggccgtgggcgccgcc
ttcgcgtcctcctggaagaccgggctggccacctcgctggccgtgttctgccacgagttg
ccacacgagctgggggacttcgccgccttgctgcacgcggggctgtccgtgcgccaagca
ctgctgctgaacctggcctccgcgctcacggccttcgctggtctctacgtggcactcgcg
gttggagtcagcgaggagagcgaggcctggatcctggcagtggccaccggcctgttcctc
tacgtagcactctgcgacatgctcccggcgatgttgaaagtacgggacccgcggccctgg
ctcctcttcctgctgcacaacgtgggcctgctgggcggctggaccgtcctgctgctgctg
tccctgtacgaggatgacatcaccttctga

DBGET integrated database retrieval system