KEGG   Homo sapiens (human): 55654Help
Entry
55654             CDS       T01001                                 

Gene name
TMEM127
Definition
transmembrane protein 127
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
2q11.2
AA seq 238 aa AA seqDB search
MYAPGGAGLPGGRRRRSPGGSALPKQPERSLASALPGALSITALCTALAEPAWLHIHGGT
CSRQELGVSDVLGYVHPDLLKDFCMNPQTVLLLRVIAAFCFLGILCSLSAFLLDVFGPKH
PALKITRRYAFAHILTVLQCATVIGFSYWASELILAQQQQHKKYHGSQVYVTFAVSFYLV
AGAGGASILATAANLLRHYPTEEEEQALELLSEMEENEPYPAEYEVINQFQPPPAYTP
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcccccggaggcgcagggctgcccggcgggcgccggcggaggagcccgggaggc
agcgctctgcccaagcagccggagcgtagcctggcctcggccctgcctggcgccctgtct
atcacggcgctgtgcactgccctcgccgagcccgcctggttgcacatccacggaggcacc
tgttcgcgccaggagctgggggtctccgacgtgttgggctatgtgcacccggacctgctg
aaagatttctgcatgaatccccagacagtgctgctcctgcgggtcatcgccgccttctgt
ttcctgggcatcctgtgtagtctctccgctttccttctggatgtctttgggccgaagcat
cctgctctgaagatcactcgtcgctatgccttcgcccatatcctaacggttctgcagtgt
gccaccgtcattggcttttcttattgggcttctgaactcatcttggcccagcagcagcag
cataagaagtaccatggatcccaggtctatgtcaccttcgccgttagcttctacctggtg
gcaggagctggtggagcctcaatcctggccacggcagccaacctcctgcgccactacccc
acagaggaagaggagcaggcgctggagctgctctcagagatggaagagaacgagccctac
ccggcggaatatgaggtcatcaaccagttccagccaccccctgcttacacaccctaa

DBGET integrated database retrieval system