KEGG   Homo sapiens (human): 55898Help
Entry
55898             CDS       T01001                                 

Gene name
UNC45A, GC-UNC45, GCUNC-45, GCUNC45, IRO039700, SMAP-1, SMAP1, UNC-45A
Definition
(RefSeq) unc-45 myosin chaperone A
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q26.1
AA seq 944 aa AA seqDB search
MTVSGPGTPEPRPATPGASSVEQLRKEGNELFKCGDYGGALAAYTQALGLDATPQDQAVL
HRNRAACHLKLEDYDKAETEASKAIEKDGGDVKALYRRSQALEKLGRLDQAVLDLQRCVS
LEPKNKVFQEALRNIGGQIQEKVRYMSSTDAKVEQMFQILLDPEEKGTEKKQKASQNLVV
LAREDAGAEKIFRSNGVQLLQRLLDMGETDLMLAALRTLVGICSEHQSRTVATLSILGTR
RVVSILGVESQAVSLAACHLLQVMFDALKEGVKKGFRGKEGAIIVDPARELKVLISNLLD
LLTEVGVSGQGRDNALTLLIKAVPRKSLKDPNNSLTLWVIDQGLKKILEVGGSLQDPPGE
LAVTANSRMSASILLSKLFDDLKCDAERENFHRLCENYIKSWFEGQGLAGKLRAIQTVSC
LLQGPCDAGNRALELSGVMESVIALCASEQEEEQLVAVEALIHAAGKAKRASFITANGVS
LLKDLYKCSEKDSIRIRALVGLCKLGSAGGTDFSMKQFAEGSTLKLAKQCRKWLCNDQID
AGTRRWAVEGLAYLTFDADVKEEFVEDAAALKALFQLSRLEERSVLFAVASALVNCTNSY
DYEEPDPKMVELAKYAKQHVPEQHPKDKPSFVRARVKKLLAAGVVSAMVCMVKTESPVLT
SSCRELLSRVFLALVEEVEDRGTVVAQGGGRALIPLALEGTDVGQTKAAQALAKLTITSN
PEMTFPGERIYEVVRPLVSLLHLNCSGLQNFEALMALTNLAGISERLRQKILKEKAVPMI
EGYMFEEHEMIRRAATECMCNLAMSKEVQDLFEAQGNDRLKLLVLYSGEDDELLQRAAAG
GLAMLTSMRPTLCSRIPQVTTHWLEILQALLLSSNQELQHRGAVVVLNMVEASREIASTL
MESEMMEILSVLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDGE
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgagtggtccagggacccccgagccccggccggccacccccggggccagctca
gtggagcagctgcggaaggagggcaatgagctgttcaaatgtggagactacgggggcgcc
ctggcggcctacactcaggccctgggtctggacgcgacgccccaggaccaggccgttctg
caccggaaccgggccgcctgccacctcaagctggaagattacgacaaagcagaaacagag
gcatccaaagccattgaaaaggatggtggggatgtcaaagcactctaccggcggagccaa
gccctagagaagctgggccgcctggaccaggctgtccttgacctgcagagatgtgtgagc
ttggagcccaagaacaaagttttccaggaggccttgcggaacatcgggggccagattcag
gagaaggtgcgatacatgtcctcgacggatgccaaagtggaacagatgtttcagatactg
ttggacccagaagagaagggcactgagaaaaagcaaaaggcttctcagaacctggtggtg
ctggccagggaggatgctggagcggagaagatcttccggagtaatggggttcagctcttg
caacgtttactggacatgggagagactgacctcatgctggcggctctgcgtacgctggtt
ggcatttgctctgagcatcagtcacggacagtggcaaccctgagcatactgggaactcgg
cgagtagtctccatcctgggcgtggaaagccaggctgtgtccctggctgcctgccacctg
ctgcaggttatgtttgatgccctcaaggaaggtgtcaaaaaaggcttccgaggcaaagaa
ggtgccatcattgtggatcctgcccgggagctgaaggtcctcatcagtaacctcttagat
ctgctgacagaggtgggggtctctggccaaggccgagacaatgccctgaccctcctgatt
aaagcggtgccccggaagtctctcaaggaccccaacaacagcctcaccctctgggtcatc
gaccaaggtctgaaaaagattttggaagtggggggctctctacaggaccctcctggggag
ctcgcagtgaccgcaaacagccgcatgagcgcctctattctcctcagcaagctctttgat
gacctcaagtgtgatgcggagagggagaatttccacagactttgtgaaaactacatcaag
agctggtttgagggccaagggctggccgggaagctacgggccatccagacggtgtcctgc
ctcctgcagggcccatgtgacgctggcaaccgggccttggagctgagcggtgtcatggag
agtgtgattgctctgtgtgcctctgagcaggaggaggagcagctggtggccgtggaggct
ctgatccatgcagccggcaaggctaagcgggcctcattcatcactgccaatggtgtctcg
ctgctgaaggacctatataagtgcagcgagaaggacagcatccgcatccgggcgctagtg
ggactctgtaagctcggttcggctggagggactgacttcagcatgaagcagtttgctgaa
ggctccactctcaaactggctaagcagtgtcgaaagtggctgtgcaatgaccagatcgac
gcaggcactcggcgctgggcagtggagggcctggcttacctgacctttgatgccgacgtg
aaggaagagtttgtggaggatgcggctgctctgaaagctctgttccagctcagcaggttg
gaggagaggtcagtgctctttgcggtggcctcagcgctggtgaactgcaccaacagctat
gactacgaggagcccgaccccaagatggtggagctggccaagtatgccaagcagcatgtg
cccgagcagcaccccaaggacaagccaagcttcgtgcgggctcgggtgaagaagctgctg
gcagcgggtgtggtgtcggccatggtgtgcatggtgaagacggagagccctgtgctgacc
agttcctgcagagagctgctctccagggtcttcttggctttagtggaagaggtagaggac
cgaggcactgtggttgcccagggaggcggcagggcgctgatcccgctggccctggaaggc
acggacgtggggcagacaaaggcagcccaggcccttgccaagctcaccatcacctccaac
ccggagatgaccttccctggcgagcggatctatgaggtggtccggcccctcgtctccctg
ttgcacctcaactgctcaggcctgcagaacttcgaggcgctcatggccctaacaaacctg
gctgggatcagcgagaggctccggcagaagatcctgaaggagaaggctgtgcccatgata
gaaggctacatgtttgaggagcatgagatgatccgccgggcagccacggagtgcatgtgt
aacttggccatgagcaaggaggtgcaggacctcttcgaagcccagggcaatgaccgactg
aagctgctggtgctgtacagtggagaggatgatgagctgctacagcgggcagctgccggg
ggcttggccatgcttacctccatgcggcccacgctctgcagccgcattccccaagtgacc
acacactggctggagatcctgcaggccctgcttctgagctccaaccaggagctgcagcac
cggggtgctgtggtggtgctgaacatggtggaggcctcgagggagattgccagcaccctg
atggagagtgagatgatggagatcttgtcagtgctagctaagggtgaccacagccctgtc
acaagggctgctgcagcctgcctggacaaagcagtggaatatgggcttatccaacccaac
caagatggagagtga

DBGET integrated database retrieval system