KEGG   Homo sapiens (human): 5664Help
Entry
5664              CDS       T01001                                 

Gene name
PSEN2, AD3L, AD4, CMD1V, PS2, STM2
Definition
presenilin 2
Orthology
K04522  
presenilin 2 [EC:3.4.23.-]
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Neurotrophin signaling pathway
Alzheimer's disease
Module
Notch signaling
Disease
H00056  
Alzheimer's disease (AD)
H00294  
Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    5664 (PSEN2)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    5664 (PSEN2)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    5664 (PSEN2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.-  
     5664 (PSEN2)
Peptidases [BR:hsa01002]
 Aspartic Peptidases
  Family A22: presenilin family
   5664 (PSEN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q42.13
AA seq 448 aa AA seqDB search
MLTFMASDSEEEVCDERTSLMSAESPTPRSCQEGRQGPEDGENTAQWRSQENEEDGEEDP
DRYVCSGVPGRPPGLEEELTLKYGAKHVIMLFVPVTLCMIVVVATIKSVRFYTEKNGQLI
YTPFTEDTPSVGQRLLNSVLNTLIMISVIVVMTIFLVVLYKYRCYKFIHGWLIMSSLMLL
FLFTYIYLGEVLKTYNVAMDYPTLLLTVWNFGAVGMVCIHWKGPLVLQQAYLIMISALMA
LVFIKYLPEWSAWVILGAISVYDLVAVLCPKGPLRMLVETAQERNEPIFPALIYSSAMVW
TVGMAKLDPSSQGALQLPYDPEMEEDSYDSFGEPSYPEVFEPPLTGYPGEELEEEEERGV
KLGLGDFIFYSVLVGKAAATGSGDWNTTLACFVAILIGLCLTLLLLAVFKKALPALPISI
TFGLIFYFSTDNLVRPFMDTLASHQLYI
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgctcacattcatggcctctgacagcgaggaagaagtgtgtgatgagcggacgtcccta
atgtcggctgagagccccacgccgcgctcctgccaggagggcaggcagggcccagaggat
ggagagaacactgcccagtggagaagccaggagaacgaggaggacggtgaggaggaccct
gaccgctatgtctgtagtggggttcccgggcggccgccaggcctggaggaagagctgacc
ctcaaatacggagcgaagcacgtgatcatgctgtttgtgcctgtcactctgtgcatgatc
gtggtggtagccaccatcaagtctgtgcgcttctacacagagaagaatggacagctcatc
tacacgccattcactgaggacacaccctcggtgggccagcgcctcctcaactccgtgctg
aacaccctcatcatgatcagcgtcatcgtggttatgaccatcttcttggtggtgctctac
aagtaccgctgctacaagttcatccatggctggttgatcatgtcttcactgatgctgctg
ttcctcttcacctatatctaccttggggaagtgctcaagacctacaatgtggccatggac
taccccaccctcttgctgactgtctggaacttcggggcagtgggcatggtgtgcatccac
tggaagggccctctggtgctgcagcaggcctacctcatcatgatcagtgcgctcatggcc
ctagtgttcatcaagtacctcccagagtggtccgcgtgggtcatcctgggcgccatctct
gtgtatgatctcgtggctgtgctgtgtcccaaagggcctctgagaatgctggtagaaact
gcccaggagagaaatgagcccatattccctgccctgatatactcatctgccatggtgtgg
acggttggcatggcgaagctggacccctcctctcagggtgccctccagctcccctacgac
ccggagatggaagaagactcctatgacagttttggggagccttcataccccgaagtcttt
gagcctcccttgactggctacccaggggaggagctggaggaagaggaggaaaggggcgtg
aagcttggcctcggggacttcatcttctacagtgtgctggtgggcaaggcggctgccacg
ggcagcggggactggaataccacgctggcctgcttcgtggccatcctcattggcttgtgt
ctgaccctcctgctgcttgctgtgttcaagaaggcgctgcccgccctccccatctccatc
acgttcgggctcatcttttacttctccacggacaacctggtgcggccgttcatggacacc
ctggcctcccatcagctctacatctga

DBGET integrated database retrieval system