KEGG   Homo sapiens (human): 56950Help
Entry
56950             CDS       T01001                                 

Gene name
SMYD2, HSKM-B, KMT3C, ZMYND14
Definition
(RefSeq) SET and MYND domain containing 2 (EC:2.1.1.43)
  KO
K11426  
SET and MYND domain-containing protein
Organism
hsa  Homo sapiens (human)
Brite
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     56950 (SMYD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q32.3
AA seq 433 aa AA seqDB search
MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKE
GLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHP
ERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVN
CNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSY
IDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARN
VIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGAL
QYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDH
PYISEIKQEIESH
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgagggccgagggcctcggcggcctggagcgcttctgcagcccgggcaaaggccggggg
ctgcgggctctgcagcccttccaggtgggggacttgctgttctcctgcccggcctatgcc
tacgtgctcacggtcaacgagcggggcaaccactgcgagtactgcttcaccaggaaagaa
ggattgtccaaatgtggaagatgcaagcaggcattttactgcaatgtggagtgtcagaaa
gaagattggcccatgcacaagctggaatgttctcccatggttgtttttggggaaaactgg
aatccctcggagactgtaagactaacagcaaggattctggccaaacagaaaatccaccca
gagagaacaccttcggaaaaattgttagctgtgaaggagtttgaatcacatctggataag
ttagacaatgagaagaaggatttgattcagagtgacatagctgctctccatcacttttac
tccaagcatctcggattccctgacaatgatagcctcgtagtactctttgcacaggttaac
tgtaatggcttcacaattgaagatgaagaactttctcatttgggatcagcgatatttcct
gatgttgcattgatgaatcatagctgttgccccaatgtcattgtgacctacaaagggacc
ctggcagaagtcagagctgtacaggaaatcaagccgggagaggaggtttttaccagctat
attgatctcctgtacccaacggaagatagaaatgaccggttaagagattcttatttcttt
acctgtgagtgccaggagtgtaccaccaaggacaaggataaggccaaggtggaaatccgg
aagctcagcgatcccccaaaggcagaagccatccgagacatggtcagatatgcacgcaac
gtcattgaagagttccggagggccaagcactataaatcccctagtgagctgctggagatc
tgcgagctcagccaggagaagatgagctctgtgtttgaggacagtaacgtgtacatgttg
cacatgatgtaccaggccatgggtgtctgcttgtacatgcaggactgggaaggagccctg
caatatggacagaaaatcattaagccctacagtaagcactatcctttgtactccctcaac
gtggcctccatgtggttgaagctagggagactctacatgggcctggaacacaaagccgca
ggggagaaagccctgaagaaggccattgcaatcatggaagtagctcacggcaaagatcat
ccatatatttctgagatcaaacaggaaattgaaagccactga

DBGET integrated database retrieval system