KEGG   Homo sapiens (human): 57190Help
Entry
57190             CDS       T01001                                 

Gene name
SEPN1, CFTD, MDRS1, RSMD1, RSS, SELN
Definition
selenoprotein N, 1
Organism
hsa  Homo sapiens (human)
Disease
H00590  
Congenital muscular dystrophies (CMD/MDC)
H00701  
Congenital fiber type disproportion (CFTD)
H01310  
Multi-minicore disease (MmD)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.13
AA seq 590 aa AA seqDB search
MGRARPGQRGPPSPGPAAQPPAPPRRRARSLALLGALLAAAAAAAVRVCARHAEAQAAAR
QELALKTLGTDGLFLFSSLDTDGDMYISPEEFKPIAEKLTGSCSVTQTGVQWCSHSSLQP
QLPWLNUSSCLSLLRSTPAASCEEEELPPDPSEETLTIEARFQPLLPETMTKSKDGFLGV
SRLALSGLRNWTAAASPSAVFATRHFQPFLPPPGQELGEPWWIIPSELSMFTGYLSNNRF
YPPPPKGKEVIIHRLLSMFHPRPFVKTRFAPQGAVACLTAISDFYYTVMFRIHAEFQLSE
PPDFPFWFSPAQFTGHIILSKDATHVRDFRLFVPNHRSLNVDMEWLYGASESSNMEVDIG
YIPQMELEATGPSVPSVILDEDGSMIDSHLPSGEPLQFVFEEIKWQQELSWEEAARRLEV
AMYPFKKVSYLPFTEAFDRAKAENKLVHSILLWGALDDQSCUGSGRTLRETVLESSPILT
LLNESFISTWSLVKELEELQNNQENSSHQKLAGLHLEKYSFPVEMMICLPNGTVVHHINA
NYFLDITSVKPEEIESNLFSFSSTFEDPSTATYMQFLKEGLRRGLPLLQP
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgggccgggcccggccgggccaacgcgggccgcccagccccggccccgccgcgcagcct
cccgcgccaccgcgccgccgcgcccgttccctggcgctgctcggagccctgctggccgcc
gccgctgccgccgccgtccgggtctgcgcccgccacgccgaggcccaggcggccgcgcgg
caggaactggcgctgaagaccctggggacagatggcctttttctcttttcctccttggac
actgacggggatatgtacatcagccctgaggagttcaaacccattgctgagaagctaaca
gggtcttgttctgtcacccagactggagtgcagtggtgcagtcacagctcactgcagcct
caacttccctggctcaattgatcctcctgcctcagcctcctgaggtcaactcccgcggcc
agctgcgaggaggaggagttgccccctgaccctagcgaggagacgctcaccatagaagcc
cgattccagcctctgctcccggagaccatgaccaagagcaaagatggcttcctaggggtc
tcccgcctcgccctgtccggcctccgaaactggacagccgccgcctcaccaagtgcagtg
tttgccacccgccacttccagcccttccttcccccgccaggccaggagctgggtgagccc
tggtggatcatccccagtgagctgagcatgttcactggctacctgtccaacaaccgcttc
tatccaccgccgcccaagggcaaggaggtcatcatccaccggctcctgagcatgttccac
cctcggccctttgtgaagacccgctttgcccctcagggagctgtggcctgcctgactgcc
atcagcgacttctactacactgtgatgttccggatccatgccgagttccagctcagtgag
ccgcccgacttccccttttggttctcccctgctcagttcaccggccacatcatcctctcc
aaagacgccacccacgtccgcgacttccggctcttcgtgcccaaccacaggtctctgaat
gtggacatggagtggctttacggggccagtgaaagcagcaacatggaggtggacatcggc
tacataccccagatggagctggaggccacgggcccctctgtgccctccgtgatcctggat
gaggatggcagcatgatcgacagccacctgccttcaggggagcccctgcagtttgtgttt
gaggagatcaagtggcagcaggagctgagctgggaggaggctgcccggcgcctggaggtg
gccatgtaccccttcaagaaggtctcctacttgccgttcactgaggccttcgaccgagcc
aaggctgagaacaagctggtgcactcaatcctgctgtggggggccctggatgaccagtcc
tgctgaggttcagggcggactctccgggagactgtcctggaaagttcgcccatcctcacc
ctgctcaacgagagcttcatcagcacctggtccctggtgaaggagctggaggaactgcag
aacaaccaggagaactcgtcccaccagaagctggctggcctgcacctggagaagtacagc
ttccccgtggagatgatgatctgcctgcccaatggcaccgtggtccatcacatcaatgcc
aactacttcttggacatcacctccgtgaagcccgaggaaatcgagagcaatctcttcagc
ttctcatccacctttgaagacccgtccacggccacctacatgcagttcctgaaggaggga
ctccggcgtggcctgcccctcctccagccctag

DBGET integrated database retrieval system