KEGG   Homo sapiens (human): 57514Help
Entry
57514             CDS       T01001                                 

Gene name
ARHGAP31, AOS1, CDGAP
Definition
Rho GTPase activating protein 31
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q13.33
AA seq 1444 aa AA seqDB search
MKNKGAKQKLKRKGAASAFGCDLTEYLESSGQDVPYVLKSCAEFIETHGIVDGIYRLSGV
TSNIQRLRQEFGSDQCPDLTREVYLQDIHCVGSLCKLYFRELPNPLLTYELYEKFTEAVS
HCPEEGQLARIQNVIQELPPSHYRTLEYLIRHLAHIASFSSKTNMHARNLALVWAPNLLR
SKEIEATGCNGDAAFLAVRVQQVVIEFILNHVDQIFNNGAPGSLENDENRPIMKSLTLPA
LSLPMKLVSLEEAQARSLATNHPARKERRENSLPEIVPPMGTLFHTVLELPDNKRKLSSK
SKKWKSIFNLGRSGSDSKSKLSRNGSVFVRGQRLSVEKATIRPAKSMDSLCSVPVEGKET
KGNFNRTVTTGGFFIPATKMHSTGTGSSCDLTKQEGEWGQEGMPPGAEGGFDVSSDRSHL
QGAQARPPPEQLKVFRPVEDPESEQTAPKMLGMFYTSNDSPSKSVFTSSLFQMEPSPRNQ
RKALNISEPFAVSVPLRVSAVISTNSTPCRTPPKELQSLSSLEEFSFHGSESGGWPEEEK
PLGAETSAASVPKKAGLEDAKAVPEAPGTVECSKGLSQEPGAHLEEKKTPESSLSSQHLN
ELEKRPNPEKVVEEGREAGEMESSTLQESPRARAEAVLLHEMDEDDLANALIWPEIQQEL
KIIESEEELSSLPPPALKTSPIQPILESSLGPFIPSEPPGSLPCGSFPAPVSTPLEVWTR
DPANQSTQGASTAASREKPEPEQGLHPDLASLAPLEIVPFEKASPQATVEVGGPGNLSPP
LPPAPPPPTPLEESTPVLLSKGGPEREDSSRKLRTDLYIDQLKSQDSPEISSLCQGEEAT
PRHSDKQNSKNAASEGKGCGFPSPTREVEIVSQEEEDVTHSVQEPSDCDEDDTVTDIAQH
GLEMVEPWEEPQWVTSPLHSPTLKDAHKAQVQGLQGHQLEKRLSHRPSLRQSHSLDSKPT
VKSQWTLEVPSSSSCANLETERNSDPLQPQAPRREITGWDEKALRSFREFSGLKGAEAPP
NQKGPSGVQPNPAETSPISLAEGKELGTHLGHSSPQIRQGGVPGPESSKESSPSVQDSTS
PGEHPAKLQLKSTECGPPKGKNRPSSLNLDPAIPIADLFWFENVASFSSPGMQVSEPGDP
KVTWMTSSYCKADPWRVYSQDPQDLDIVAHALTGRRNSAPVSVSAVRTSFMVKMCQARAV
PVIPPKIQYTQIPQPLPSQSSGENGVQPLERSQEGPSSTSGTTQKPAKDDSPSSLESSKE
EKPKQDPGAIKSSPVDATAPCMCEGPTLSPEPGSSNLLSTQDAVVQCRKRMSETEPSGDN
LLSSKLERPSGGSKPFHRSRPGRPQSLILFSPPFPIMDHLPPSSTVTDSKVLLSPIRSPT
QTVSPGLLCGELAENTWVTPEGVTLRNKMTIPKNGQRLETSTSCFYQPQRRSVILDGRSG
RQIE
NT seq 4335 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacaagggtgctaagcagaagctgaaacgaaagggagccgccagcgcgtttggc
tgtgacctgacggagtatctggaaagctcgggacaggatgttccatacgttttgaagagc
tgtgcagaatttatagagactcacggcatcgtggatggaatctatcggctttcaggagtc
acctcaaacatacaacggctaaggcaagagtttggctcagatcaatgtccagatctgaca
agggaagtgtacctccaggacatccactgtgtgggctcgctttgcaagctctactttagg
gagctgcccaaccccctcctgacttatgagctctatgagaaattcacggaggcagtgtcg
cattgccctgaagaaggccaactggcccgaatccaaaatgttatccaggagcttcctcca
tcccactataggaccttggaatacctgattcgacacctggcccatatcgcctccttcagc
agcaagaccaacatgcacgcccggaacctggccctggtgtgggcgccaaacctcctcagg
tctaaagaaattgaagccactggttgcaatggagatgcagccttccttgcagtccgggtc
cagcaggtggtgattgagttcatattgaatcatgtagatcaaatctttaacaacggtgca
cctgggtctctggagaatgatgaaaaccggcccatcatgaagagcctgaccttgccagcc
ctctccctgcccatgaagctggtgagccttgaggaagctcaagcccgcagcctggccact
aaccatcctgctcgcaaggaaaggagggagaacagcctgcctgagattgtccctcccatg
ggcaccctcttccacactgtccttgagttaccagacaacaagcgaaagctctccagtaaa
tcaaagaagtggaaatcaatatttaacctgggacgttctggatcagactccaaatcaaaa
ctgagtagaaatgggagtgtatttgtgagaggacagaggctctcggtggaaaaggctact
atccgaccagctaaaagcatggactcactatgttcagtgcctgtggaaggaaaagaaacc
aagggaaatttcaatcgaacagttaccaccggtggatttttcattccagcaacaaagatg
cactccaccggcaccggcagctcatgtgacctcaccaagcaggagggcgaatggggccag
gaggggatgcctcccggggctgagggtggctttgatgtgagcagtgatcgcagccatctc
cagggcgctcaggcccggcccccaccggaacagctgaaggttttccggcctgttgaggat
ccggagagcgagcaaacagccccaaagatgttgggtatgttctacacttcgaacgacagc
cctagcaaatccgtcttcaccagcagcctcttccagatggagccctcgccgcgtaaccag
cgcaaggcgctgaacatctccgagccctttgcggtatctgtgccgctccgcgtgtccgca
gtcatcagcaccaacagcacgccgtgcagaacacccccgaaggagctgcagtctctttcc
agcctggaagagttttcttttcatggatcagagagcggaggctggccagaagaagagaaa
ccgctgggagctgagacttctgcagcttctgtacctaagaaggcaggtcttgaggatgcc
aaggcagtacctgaagcaccggggacagtggaatgcagcaaaggcctgtcccaggagcca
ggcgcccacctggaggagaagaaaaccccagaaagctccttgagctctcaacatttaaat
gaattagagaagaggccaaatccggagaaggtggtggaggagggacgagaggctggtgag
atggagtccagcaccctgcaggagagccccagggccagagccgaagctgtgcttctccat
gagatggatgaagatgatctggccaatgccctgatctggcctgagattcaacaggagctg
aaaatcattgaatctgaggaggagctctcatcgttgccacctcctgctctgaagaccagc
ccaattcagcctattctcgagtcgagtctggggccctttattccctcagagcctcctggg
agcttgccttgtggctccttccctgctccagtctccacccctctggaggtgtggactagg
gatccagccaatcagagcacacagggggcttccacagcagccagcagagagaagccggaa
cctgagcagggcctgcacccagacctcgccagcctggctcctctggaaatagttcctttt
gagaaggcatctccacaagcaacagtggaagtaggaggcccaggcaatctgtctcctcca
ctcccacctgctcctccccctccaactcctctggaggagtcaactccagtcctgctttca
aagggcggcccggaaagagaagactcatccaggaaattgaggacagatctctacatagac
cagctgaagtcccaagacagccctgagatctctagcctctgtcagggagaggaggcaacc
ccaagacacagtgacaagcaaaattcaaagaatgctgcttctgaggggaaaggctgtggt
tttccaagcccaaccagggaggttgagatcgtctcacaagaagaggaggatgtaacccat
tcagtacaggagccttcagactgtgacgaagatgacactgtgacagacattgcccagcat
ggcctggagatggtggagccctgggaggaaccccagtgggtgacgagtccccttcactct
cccaccctgaaagacgcgcacaaggcccaggtacagggccttcagggtcaccagttggag
aagaggctttcccacaggcccagccttcgccagagccattctctagatagcaaacccacg
gttaaaagccagtggactctcgaggttccctcctccagcagctgtgctaatcttgaaaca
gagaggaattctgaccctcttcagccccaggcacccaggagagagattactggatgggat
gagaaagccctgaggtccttcagagagttctctggcctgaaaggggcagaggctcctccc
aaccagaagggaccaagtggtgtgcaacccaacccagcagaaaccagccccatcagccta
gcagagggaaaggagctagggacacacctggggcacagcagtccacagattaggcaaggt
ggtgttcctgggccagagagcagcaaggagagttcacccagcgtgcaggacagcacttcg
cctggagagcaccccgcaaagttacagctaaagagcacagagtgtgggcccccaaaaggg
aaaaacaggccttcttccctcaacttggaccctgccattcccattgctgacctcttctgg
tttgagaatgtggcctcatttagttcacctggaatgcaggtctctgagccaggagaccca
aaggtcacatggatgacctcatcttactgtaaagcagacccctggagggtttactcccag
gacccccaggacctggacattgttgctcatgcactgacaggccgccgtaactcagctcct
gtgagtgtgtcagctgtgagaacctccttcatggtcaaaatgtgccaggccagggcggtc
ccagtcatccctcccaagattcagtacacccagatcccacagcccctgccctctcagagc
tcaggggagaatggggttcagcctctggagaggagccaggagggacccagctcaaccagt
gggaccactcagaaacctgccaaagatgattctccctcctccctggaaagctcaaaggaa
gaaaaaccaaagcaagatcccggagccattaagtcctcaccagtggatgccactgcaccc
tgcatgtgcgagggacctaccctttctccagaaccaggctcgtctaacctgctctccacc
caggatgcagtagtgcaatgcagaaagcgcatgtcagagacagagccatctggggacaac
cttctttcttcaaaactagagcgaccatctgggggttctaagcctttccacaggtcaagg
ccaggaagacctcagagcctaatcttattcagtcctcctttccccattatggaccacctg
cccccttcatccacagtgacagattccaaggtcctgctgtcccctatcagaagtcccacc
cagacagtttcccctggccttctttgtggagagttggcagaaaacacatgggtcacacca
gaaggggttacacttaggaataaaatgaccatccctaagaatggccagagactagagacc
tcaaccagctgtttttaccagcctcagcggagatcagtaattctggatggaagaagtggg
aggcaaatagaatga

DBGET integrated database retrieval system