KEGG   Homo sapiens (human): 57716Help
Entry
57716             CDS       T01001                                 

Gene name
PRX, CMT4F
Definition
(RefSeq) periaxin
Organism
hsa  Homo sapiens (human)
Disease
H00264  
Charcot-Marie-Tooth disease (CMT)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.2
AA seq 1461 aa AA seqDB search
MEARSRSAEELRRAELVEIIVETEAQTGVSGINVAGGGKEGIFVRELREDSPAARSLSLQ
EGDQLLSARVFFENFKYEDALRLLQCAEPYKVSFCLKRTVPTGDLALRPGTVSGYEIKGP
RAKVAKLNIQSLSPVKKKKMVPGALGVPADLAPVDVEFSFPKFSRLRRGLKAEAVKGPVP
AAPARRRLQLPRLRVREVAEEAQAARLAAAAPPPRKAKVEAEVAAGARFTAPQVELVGPR
LPGAEVGVPQVSAPKAAPSAEAAGGFALHLPTLGLGAPAPPAVEAPAVGIQVPQVELPAL
PSLPTLPTLPCLETREGAVSVVVPTLDVAAPTVGVDLALPGAEVEARGEAPEVALKMPRL
SFPRFGARAKEVAEAKVAKVSPEARVKGPRLRMPTFGLSLLEPRPAAPEVVESKLKLPTI
KMPSLGIGVSGPEVKVPKGPEVKLPKAPEVKLPKVPEAALPEVRLPEVELPKVSEMKLPK
VPEMAVPEVRLPEVELPKVSEMKLPKVPEMAVPEVRLPEVQLLKVSEMKLPKVPEMAVPE
VRLPEVQLPKVSEMKLPEVSEVAVPEVRLPEVQLPKVPEMKVPEMKLPKVPEMKLPEMKL
PEVQLPKVPEMAVPDVHLPEVQLPKVPEMKLPEMKLPEVKLPKVPEMAVPDVHLPEVQLP
KVPEMKLPKMPEMAVPEVRLPEVQLPKVSEMKLPKVPEMAVPDVHLPEVQLPKVCEMKVP
DMKLPEIKLPKVPEMAVPDVHLPEVQLPKVSEIRLPEMQVPKVPDVHLPKAPEVKLPRAP
EVQLKATKAEQAEGMEFGFKMPKMTMPKLGRAESPSRGKPGEAGAEVSGKLVTLPCLQPE
VDGEAHVGVPSLTLPSVELDLPGALGLQGQVPAAKMGKGERVEGPEVAAGVREVGFRVPS
VEIVTPQLPAVEIEEGRLEMIETKVKPSSKFSLPKFGLSGPKVAKAEAEGAGRATKLKVS
KFAISLPKARVGAEAEAKGAGEAGLLPALDLSIPQLSLDAHLPSGKVEVAGADLKFKGPR
FALPKFGVRGRDTEAAELVPGVAELEGKGWGWDGRVKMPKLKMPSFGLARGKEAEVQGDR
ASPGEKAESTAVQLKIPEVELVTLGAQEEGRAEGAVAVSGMQLSGLKVSTAGQVVTEGHD
AGLRMPPLGISLPQVELTGFGEAGTPGQQAQSTVPSAEGTAGYRVQVPQVTLSLPGAQVA
GGELLVGEGVFKMPTVTVPQLELDVGLSREAQAGEAATGEGGLRLKLPTLGARARVGGEG
AEEQPPGAERTFCLSLPDVELSPSGGNHAEYQVAEGEGEAGHKLKVRLPRFGLVRAKEGA
EEGEKAKSPKLRLPRVGFSQSEMVTGEGSPSPEEEEEEEEEGSGEGASGRRGRVRVRLPR
VGLAAPSKASRGQEGDAAPKSPVREKSPKFRFPRVSLSPKARSGSGDQEEGGLRVRLPSV
GFSETGAPGPARMEGAQAAAV
NT seq 4386 nt NT seq  +upstreamnt  +downstreamnt
atggaggccaggagccggagtgccgaggagctgaggcgggcggagttggtggaaattatc
gtggagacggaggcgcagaccggggtcagcggcatcaacgtagcgggcggcggcaaagag
ggaatcttcgttcgggagctgcgcgaggactcacccgccgccaggagcctcagcctgcag
gaaggggaccagctgctgagtgcccgagtgttcttcgagaacttcaagtacgaggacgca
ctacgcctgctgcaatgcgccgagccttacaaagtctccttctgcctgaagcgcactgtg
cccaccggggacctggctctgcggcccgggaccgtgtctggctacgagatcaagggcccg
cgggccaaggtggccaagctgaacatccagagtctgtcccctgtgaagaagaagaagatg
gtgcctggggctctgggggtccccgctgacctggcccctgttgacgtcgagttctccttt
cccaagttctcccgcctgcgtcggggcctcaaagccgaggctgtcaagggtcctgtcccg
gctgcccctgcccgccggcgcctccagctgcctcggctgcgtgtacgagaagtggccgaa
gaggctcaggcagcccggctggccgccgccgctcctccccccaggaaagccaaggtggag
gctgaggtggctgcaggagctcgtttcacagcccctcaggtggagctggttgggccgcgg
ctgccaggggcggaggtgggtgtcccccaggtctcagcccccaaggctgccccctcagca
gaggcagctggtggctttgccctccacctgccaacccttgggctcggagccccggctccg
cctgctgtggaggccccagccgtgggaatccaggtcccccaggtggagctgcctgccttg
ccctcactgcccactctgcccacacttccctgcctagagacccgggaaggggctgtgtcg
gtagtggtgcccaccctggatgtggcagcaccgactgtgggggtggacctggccttgccg
ggtgcagaggtggaggcccggggagaggcacctgaggtggccctgaagatgccccgcctt
agttttccccgatttggggctcgagcaaaggaagttgctgaggccaaggtagccaaggtc
agccctgaggccagggtgaaaggtcccagacttcgaatgcccacctttgggctttccctc
ttggagccccggcccgctgctcctgaagttgtagagagcaagctgaagctgcccaccatc
aagatgccctcccttggcatcggagtgtcagggcccgaggtcaaggtgcccaagggacct
gaagtgaagctccccaaggctcctgaggtcaagcttccaaaagtgcccgaggcagccctt
ccagaggttcgactcccagaggtggagctccccaaggtgtcagagatgaaactcccaaag
gtgccagagatggctgtgccggaggtgcggcttccagaggtagagctgcccaaagtgtca
gagatgaaactcccaaaggtgccagagatggctgtgccggaggtgcggcttccagaggta
cagctgctgaaagtgtcggagatgaaactcccaaaggtgccagagatggctgtgccggag
gtgcggcttccagaggtacagctgccgaaagtgtcagagatgaaactcccagaggtgtca
gaggtggctgtgccagaggtgcggcttccagaggtgcagctgccgaaagtgccagagatg
aaagtccctgagatgaagcttccaaaggtgcctgagatgaaacttcctgagatgaaactc
cctgaagtgcaactcccgaaggtgcccgagatggccgtgcccgatgtgcacctcccagaa
gtgcagcttccaaaagtcccagagatgaagctccctgagatgaaactccctgaggtgaaa
ctcccgaaggtgcccgagatggctgtgcccgatgtgcacctcccggaagtgcagctcccg
aaagtcccagagatgaaactccctaaaatgcctgagatggctgtgccagaggttcgactc
cccgaggtgcagctgccaaaagtctcagagatgaaactccccaaggtgcctgaaatggcc
gtgcccgatgtgcacctcccagaggtgcagctgcccaaagtctgtgaaatgaaagtccct
gacatgaagctcccagagataaaactccccaaggtgcctgagatggctgtgcccgatgtg
cacctccccgaggtgcagctgccgaaagtgtcagagattcggctgccggaaatgcaagtg
ccgaaggttcccgacgtgcatcttccgaaggcaccagaggtgaagctgcccagggctccg
gaggtgcagctaaaggccaccaaggcagaacaggcagaagggatggaatttggcttcaag
atgcccaagatgaccatgcccaagctagggagggcagagtccccatcacgtggcaagcca
ggcgaggcgggtgctgaggtctcagggaagctggtaacacttccctgtctgcagccagag
gtggatggtgaggctcatgtgggtgtcccctctctcactctgccttcagtggagctagac
ctgccaggagcacttggcctgcaggggcaggtcccagccgctaaaatgggcaagggagag
cgggtggagggccctgaggtggcagcaggggtcagggaagtgggcttccgagtgccctct
gttgaaattgtcaccccacagctgcccgccgtggaaattgaggaagggcggctggagatg
atagagacaaaagtcaagccctcttccaagttctccttacctaagtttggactctcgggg
ccaaaggtggctaaggcagaggctgagggggctgggcgagctaccaagctgaaggtatcc
aaatttgccatctcactccccaaggctcgggtgggggctgaggctgaggccaaaggggct
ggggaggcaggcctgctgcctgccctcgatctgtccatcccacagctcagcctggatgcc
cacctgccctcaggcaaggtagaggtggcaggggccgacctcaagttcaaggggcccagg
tttgctctccccaagtttggggtcagaggccgggacactgaggcagcagaactagtgcca
ggggtggctgagttggagggcaagggctggggctgggatgggagggtgaagatgcccaag
ctgaagatgccttcctttgggctggctcgagggaaggaagcagaagttcaaggtgatcgt
gccagcccgggggaaaaggctgagtccaccgctgtgcagcttaagatccccgaggtggag
ctggtcacgctgggcgcccaggaggaagggagggcagagggggctgtggccgtcagtgga
atgcagctgtcaggcctgaaggtgtccacagccgggcaggtggtcactgagggccatgac
gcggggctgaggatgcctccgctgggcatctccctgccacaggtggagctgaccggcttt
ggggaggcaggtaccccagggcagcaggctcagagtacagtcccttcagcagagggcaca
gcaggctacagggttcaggtgccccaggtgaccctgtctctgcctggagcccaggttgca
ggtggtgagctgctggtgggtgagggtgtctttaagatgcccaccgtgacagtgccccag
cttgagctggacgtggggctaagccgagaggcacaggcgggcgaggcggccacaggcgag
ggtgggctgaggctgaagttgcccacactgggggccagagctagggtggggggcgagggt
gctgaggagcagcccccaggggccgagcgtaccttctgcctctcactgcccgacgtggag
ctctcgccatccgggggcaaccatgccgagtaccaggtggcagagggggagggagaggcc
ggacacaagctcaaggtacggctgccccggtttggcctggtgcgggccaaggagggggcc
gaggagggtgagaaggccaagagccccaaactcaggctgccccgagtgggcttcagccaa
agtgagatggtcactggggaagggtcccccagccccgaggaggaggaggaggaggaggaa
gagggcagtggggaaggggcctcgggtcgccggggccgggtccgggtccgcttgccacgt
gtaggcctggcggccccttctaaagcctctcgggggcaggagggcgatgcagcccccaag
tcccccgtcagagagaagtcacccaagttccgcttccccagggtgtccctaagccccaag
gcccggagtgggagtggggaccaggaagagggtggattgcgggtgcggctgcccagcgtg
gggttttcagagacaggggctccaggcccggccaggatggagggggctcaggctgcggct
gtctga

DBGET integrated database retrieval system