KEGG   Homo sapiens (human): 57716Help
Entry
57716             CDS       T01001                                 

Gene name
PRX, CMT4F
Definition
periaxin
Organism
hsa  Homo sapiens (human)
Disease
H00264  
Charcot-Marie-Tooth disease (CMT)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.2
AA seq 147 aa AA seqDB search
MEARSRSAEELRRAELVEIIVETEAQTGVSGINVAGGGKEGIFVRELREDSPAARSLSLQ
EGDQLLSARVFFENFKYEDALRLLQCAEPYKVSFCLKRTVPTGDLALRPGTVSGYEIKGP
RAKVAKLVRVLSPAPALDCPSDPVSAP
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggaggccaggagccggagtgccgaggagctgaggcgggcggagttggtggaaattatc
gtggagacggaggcgcagaccggggtcagcggcatcaacgtagcgggcggcggcaaagag
ggaatcttcgttcgggagctgcgcgaggactcacccgccgccaggagcctcagcctgcag
gaaggggaccagctgctgagtgcccgagtgttcttcgagaacttcaagtacgaggacgca
ctacgcctgctgcaatgcgccgagccttacaaagtctccttctgcctgaagcgcactgtg
cccaccggggacctggctctgcggcccgggaccgtgtctggctacgagatcaagggcccg
cgggccaaggtggccaagctggtacgcgtgcttagcccggccccggccctggactgcccc
agcgatccggtctctgcgccgtga

DBGET integrated database retrieval system