KEGG   Homo sapiens (human): 5781Help
Entry
5781              CDS       T01001                                 

Gene name
PTPN11, BPTP3, CFC, JMML, METCDS, NS1, PTP-1D, PTP2C, SH-PTP2, SH-PTP3, SHP2
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 11
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04360  Axon guidance
hsa04625  C-type lectin receptor signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04670  Leukocyte transendothelial migration
hsa04722  Neurotrophin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04931  Insulin resistance
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05168  Herpes simplex infection
hsa05205  Proteoglycans in cancer
hsa05211  Renal cell carcinoma
hsa05220  Chronic myeloid leukemia
Disease
H00523  Noonan syndrome and related disorders
H01018  Metachondromatosis
H01738  Noonan syndrome
H01984  Leopard syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    5781 (PTPN11)
   04630 Jak-STAT signaling pathway
    5781 (PTPN11)
   04072 Phospholipase D signaling pathway
    5781 (PTPN11)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    5781 (PTPN11)
   04650 Natural killer cell mediated cytotoxicity
    5781 (PTPN11)
   04670 Leukocyte transendothelial migration
    5781 (PTPN11)
  Endocrine system
   04920 Adipocytokine signaling pathway
    5781 (PTPN11)
  Nervous system
   04722 Neurotrophin signaling pathway
    5781 (PTPN11)
  Development
   04360 Axon guidance
    5781 (PTPN11)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    5781 (PTPN11)
   05220 Chronic myeloid leukemia
    5781 (PTPN11)
   05211 Renal cell carcinoma
    5781 (PTPN11)
  Endocrine and metabolic diseases
   04931 Insulin resistance
    5781 (PTPN11)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    5781 (PTPN11)
   05168 Herpes simplex infection
    5781 (PTPN11)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     5781 (PTPN11)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    5781 (PTPN11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 5781
NCBI-ProteinID: NP_001317366
OMIM: 176876
HGNC: 9644
Ensembl: ENSG00000179295
Vega: OTTHUMG00000134334
Pharos: Q06124(Tchem)
UniProt: Q06124
Structure
PDB: 

Jmol
Position
12q24.13
AA seq 597 aa AA seqDB search
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGK
EAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYD
VGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETT
DKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEP
VSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEV
ERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKLSKVGQALLQGNTERTVW
QYHFRTWPDHGVPSDPGGVLDFLEEVHHKQESIMDAGPVVVHCSAGIGRTGTFIVIDILI
DIIREKGVDCDIDVPKTIQMVRSQRSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSK
RKGHEYTNIKYSLADQTSGDQSPLPPCTPTPPCAEMREDSARVYENVGLMQQQKSFR
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgcggagatggtttcacccaaatatcactggtgtggaggcagaaaacctactg
ttgacaagaggagttgatggcagttttttggcaaggcctagtaaaagtaaccctggagac
ttcacactttccgttagaagaaatggagctgtcacccacatcaagattcagaacactggt
gattactatgacctgtatggaggggagaaatttgccactttggctgagttggtccagtat
tacatggaacatcacgggcaattaaaagagaagaatggagatgtcattgagcttaaatat
cctctgaactgtgcagatcctacctctgaaaggtggtttcatggacatctctctgggaaa
gaagcagagaaattattaactgaaaaaggaaaacatggtagttttcttgtacgagagagc
cagagccaccctggagattttgttctttctgtgcgcactggtgatgacaaaggggagagc
aatgacggcaagtctaaagtgacccatgttatgattcgctgtcaggaactgaaatacgac
gttggtggaggagaacggtttgattctttgacagatcttgtggaacattataagaagaat
cctatggtggaaacattgggtacagtactacaactcaagcagccccttaacacgactcgt
ataaatgctgctgaaatagaaagcagagttcgagaactaagcaaattagctgagaccaca
gataaagtcaaacaaggcttttgggaagaatttgagacactacaacaacaggagtgcaaa
cttctctacagccgaaaagagggtcaaaggcaagaaaacaaaaacaaaaatagatataaa
aacatcctgccctttgatcataccagggttgtcctacacgatggtgatcccaatgagcct
gtttcagattacatcaatgcaaatatcatcatgcctgaatttgaaaccaagtgcaacaat
tcaaagcccaaaaagagttacattgccacacaaggctgcctgcaaaacacggtgaatgac
ttttggcggatggtgttccaagaaaactcccgagtgattgtcatgacaacgaaagaagtg
gagagaggaaagagtaaatgtgtcaaatactggcctgatgagtatgctctaaaagaatat
ggcgtcatgcgtgttaggaacgtcaaagaaagcgccgctcatgactatacgctaagagaa
cttaaactttcaaaggttggacaagctctactccaggggaatacggagagaacggtctgg
caataccactttcggacctggccggaccacggcgtgcccagcgaccctgggggcgtgctg
gacttcctggaggaggtgcaccataagcaggagagcatcatggatgcagggccggtcgtg
gtgcactgcagtgctggaattggccggacagggacgttcattgtgattgatattcttatt
gacatcatcagagagaaaggtgttgactgcgatattgacgttcccaaaaccatccagatg
gtgcggtctcagaggtcagggatggtccagacagaagcacagtaccgatttatctatatg
gcggtccagcattatattgaaacactacagcgcaggattgaagaagagcagaaaagcaag
aggaaagggcacgaatatacaaatattaagtattctctagcggaccagacgagtggagat
cagagccctctcccgccttgtactccaacgccaccctgtgcagaaatgagagaagacagt
gctagagtctatgaaaacgtgggcctgatgcaacagcagaaaagtttcagatga

DBGET integrated database retrieval system