KEGG   Homo sapiens (human): 579Help
Entry
579               CDS       T01001                                 

Gene name
NKX3-2, BAPX1, NKX3.2, NKX3B, SMMD
Definition
(RefSeq) NK3 homeobox 2
  KO
K09995  
homeobox protein Nkx-3.2
Organism
hsa  Homo sapiens (human)
Disease
H00863  
Spondylo-megaepiphyseal-metaphyseal dysplasia
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, NK-2
    579 (NKX3-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4p16.3
AA seq 333 aa AA seqDB search
MAVRGANTLTSFSIQAILNKKEERGGLAAPEGRPAPGGTAASVAAAPAVCCWRLFGERDA
GALGGAEDSLLASPAGTRTAAGRTAESPEGWDSDSALSEENESRRRCADARGASGAGLAG
GSLSLGQPVCELAASKDLEEEAAGRSDSEMSASVSGDRSPRTEDDGVGPRGAHVSALCSG
AGGGGGSGPAGVAEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLA
ASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLR
PPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgcgcggcgccaacaccttgacgtccttctccatccaggcgatcctcaacaag
aaagaggagcgcggcgggctggccgcgccagaggggcgcccggcgcccgggggcacagcg
gcatcggtggccgcggctcccgctgtctgctgttggcggctctttggggagagggacgcg
ggcgcgttggggggcgccgaggactctctgctggcgtctcctgccggtaccagaacagct
gcggggcggactgcggagagcccggaaggctgggactcggactccgcgctcagcgaggag
aacgagagcaggcggcgctgcgcggacgcgcggggggccagcggggccggccttgcgggg
ggatccttgagcctcggccagccggtctgtgagctggccgcttccaaagacctagaggag
gaagccgcgggccggagcgacagcgagatgtccgccagcgtctcaggcgaccgcagccca
aggaccgaggacgacggtgttggccccagaggtgcacacgtgtccgcgctgtgcagcggg
gccggcggcgggggcggcagcgggccggcaggcgtcgcggaggaggaggaggagccggcg
gcgcccaagccacgcaagaagcgctcgcgggccgctttctcccacgcgcaggtcttcgag
ctggagcgccgctttaaccaccagcgctacctgtccgggcccgagcgcgcagacctggcc
gcgtcgctgaagctcaccgagacgcaggtgaaaatctggttccagaaccgtcgctacaag
acaaagcgccggcagatggcagccgacctgctggcctcggcgcccgccgccaagaaggtg
gccgtaaaggtgctggtgcgcgacgaccagagacaatacctgcccggcgaagtgctgcgg
ccaccctcgcttctgccactgcagccctcctactattacccgtactactgcctcccaggc
tgggcgctctccacctgcgcagctgccgcaggcacccagtga

DBGET integrated database retrieval system