KEGG   Homo sapiens (human): 5837Help
Entry
5837              CDS       T01001                                 

Gene name
PYGM
Definition
(RefSeq) phosphorylase, glycogen, muscle (EC:2.4.1.1)
  KO
K00688  
starch phosphorylase [EC:2.4.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Insulin signaling pathway
Glucagon signaling pathway
Insulin resistance
Disease
H00069  
Glycogen storage diseases (GSD)
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    5837 (PYGM)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    5837 (PYGM)
   04922 Glucagon signaling pathway
    5837 (PYGM)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    5837 (PYGM)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     5837 (PYGM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q13.1
AA seq 842 aa AA seqDB search
MSRPLSDQEKRKQISVRGLAGVENVTELKKNFNRHLHFTLVKDRNVATPRDYYFALAHTV
RDHLVGRWIRTQQHYYEKDPKRIYYLSLEFYMGRTLQNTMVNLALENACDEATYQLGLDM
EELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKISGGWQMEEA
DDWLRYGNPWEKARPEFTLPVHFYGHVEHTSQGAKWVDTQVVLAMPYDTPVPGYRNNVVN
TMRLWSAKAPNDFNLKDFNVGGYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV
VAATLQDIIRRFKSSKFGCRDPVRTNFDAFPDKVAIQLNDTHPSLAIPELMRILVDLERM
DWDKAWDVTVRTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFP
GDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKF
QNKTNGITPRRWLVLCNPGLAEVIAERIGEDFISDLDQLRKLLSFVDDEAFIRDVAKVKQ
ENKLKFAAYLEREYKVHINPNSLFDIQVKRIHEYKRQLLNCLHVITLYNRIKREPNKFFV
PRTVMIGGKAAPGYHMAKMIIRLVTAIGDVVNHDPAVGDRLRVIFLENYRVSLAEKVIPA
ADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVD
KLDQRGYNAQEYYDRIPELRQVIEQLSSGFFSPKQPDLFKDIVNMLMHHDRFKVFADYED
YIKCQEKVSALYKNPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQRLPAPDE
AI
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atgtcccggcccctgtcagaccaagagaaaagaaagcaaatcagtgtgcgtggcctggcc
ggcgtggagaacgtgactgagctgaaaaagaacttcaaccggcacctgcatttcacactc
gtaaaggaccgcaatgtggccaccccacgagactactactttgctctggcccataccgtg
cgcgaccacctcgtggggcgctggatccgcacgcagcagcactactatgagaaggacccc
aagaggatctactacctgtctttagagttctatatgggacggacgctacagaacaccatg
gtgaacctggccttagagaatgcctgtgacgaggccacctaccagctgggcctggacatg
gaggagctggaggaaattgaggaggatgcggggctgggcaacgggggcctgggccggctg
gcagcctgctttcttgactccatggcaacactgggcctggccgcctatggctacgggatt
cgctatgagtttgggatttttaaccagaagatctccgggggctggcagatggaggaggcc
gatgactggcttcgctacggcaacccctgggagaaggcccggcccgagttcacgctacct
gtgcacttctacggccatgtggagcacaccagccagggtgccaagtgggtggacacacag
gtggtactggccatgccctacgatacgcccgtgcctggctatcgcaacaatgttgtcaac
accatgcgcctctggtctgccaaggctcccaatgacttcaacctcaaggacttcaatgtc
ggtggctacatccaggctgtgttggaccgaaacctggcggagaacatctctcgtgtcctg
taccccaatgataatttcttcgaagggaaggagctgcggctgaagcaggagtatttcgtg
gtggctgccaccctccaggacatcatccgtcgcttcaagtcttccaagttcggctgccgt
gatcccgtgcgcacgaacttcgatgccttcccagataaggtggccatccagctcaatgac
acccacccctccctggccatccccgagctgatgaggatcctggtggacctggaacggatg
gactgggacaaggcgtgggatgtgacagtgaggacctgtgcctacaccaaccacacggtg
ctgcccgaggccctggagcgctggccggtgcacctcttggagacgctgctgccgcggcac
ctccagatcatctacgagatcaaccagcgcttcctcaaccgggtggcggccgcattccca
ggggacgtagaccggctgcggcgcatgtcgctggtggaggagggcgcagtgaagcgcatc
aacatggcacacctgtgcatcgcggggtcgcacgccgtcaacggcgtggcgcgcatccac
tccgagatcctcaagaagaccatcttcaaagacttctatgagctggagcctcataagttc
cagaataagaccaacggcatcacccctcggcgctggctggttctgtgtaaccccgggctg
gcagaggtcattgctgagcgcatcggggaggacttcatctctgacctggaccagctgcgc
aaactgctctcctttgtggatgatgaagctttcattcgggatgtggccaaagtgaagcag
gaaaacaagttgaagtttgctgcctacctagagagggaatacaaagtccacatcaacccc
aactcactcttcgacatccaggtgaagcggattcacgaatataaacgacagctcctcaac
tgcctccatgtcatcaccctgtacaaccgcatcaagagggagcccaataagttttttgtg
cctcggactgtgatgattggagggaaggctgcacctgggtaccacatggccaagatgatc
atcagactcgtcacagccatcggggatgtggtcaaccatgacccggcagtgggtgaccgc
ctccgtgtcatcttcctggagaactaccgagtctcactggccgagaaagtgatcccagct
gcagacctctctgagcagatctccactgcgggcactgaagcctcaggcaccggcaacatg
aagttcatgctcaacggggctctgaccattggcaccatggacggggccaatgtggagatg
gcagaagaggcgggagaggaaaacttcttcatctttggcatgcgggtggaggatgtggat
aagcttgaccaaagagggtacaatgcccaggagtactacgatcgcattcctgagcttcgg
caggtcattgagcagctgagcagtggcttcttctcccccaaacagcccgacctgttcaag
gacattgtcaatatgctcatgcaccatgaccggtttaaagtcttcgcagattatgaagac
tacattaaatgccaggagaaagtcagcgccttgtacaagaacccaagagagtggacgcgg
atggtgatccggaacatagccacctctggcaagttctccagtgaccgcaccattgcccag
tatgcccgggagatctggggtgtggagccttcccgccagcgcctgccagccccggatgag
gccatctga

DBGET integrated database retrieval system