KEGG   Homo sapiens (human): 5837Help
Entry
5837              CDS       T01001                                 

Gene name
PYGM
Definition
phosphorylase, glycogen, muscle (EC:2.4.1.1)
Orthology
K00688  
starch phosphorylase [EC:2.4.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Insulin signaling pathway
Disease
H00069  
Glycogen storage diseases (GSD)
Drug target
Other: 
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:hsa00500]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hsa04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q12-q13.2
AA seq 754 aa AA seqDB search
MSRPLSDQEKRKQISVRGLAGVENVTELKKNFNRHLHFTLVKDRNVATPRDYYFALAHTV
RDHLVGRWIRTQQHYYEKDPKKISGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGHVE
HTSQGAKWVDTQVVLAMPYDTPVPGYRNNVVNTMRLWSAKAPNDFNLKDFNVGGYIQAVL
DRNLAENISRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKSSKFGCRDPVRTNFD
AFPDKVAIQLNDTHPSLAIPELMRILVDLERMDWDKAWDVTVRTCAYTNHTVLPEALERW
PVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIA
GSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEVIAERI
GEDFISDLDQLRKLLSFVDDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDIQV
KRIHEYKRQLLNCLHVITLYNRIKREPNKFFVPRTVMIGGKAAPGYHMAKMIIRLVTAIG
DVVNHDPAVGDRLRVIFLENYRVSLAEKVIPAADLSEQISTAGTEASGTGNMKFMLNGAL
TIGTMDGANVEMAEEAGEENFFIFGMRVEDVDKLDQRGYNAQEYYDRIPELRQVIEQLSS
GFFSPKQPDLFKDIVNMLMHHDRFKVFADYEDYIKCQEKVSALYKNPREWTRMVIRNIAT
SGKFSSDRTIAQYAREIWGVEPSRQRLPAPDEAI
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atgtcccggcccctgtcagaccaagagaaaagaaagcaaatcagtgtgcgtggcctggcc
ggcgtggagaacgtgactgagctgaaaaagaacttcaaccggcacctgcatttcacactc
gtaaaggaccgcaatgtggccaccccacgagactactactttgctctggcccataccgtg
cgcgaccacctcgtggggcgctggatccgcacgcagcagcactactatgagaaggacccc
aagaagatctccgggggctggcagatggaggaggccgatgactggcttcgctacggcaac
ccctgggagaaggcccggcccgagttcacgctacctgtgcacttctacggccatgtggag
cacaccagccagggtgccaagtgggtggacacacaggtggtactggccatgccctacgat
acgcccgtgcctggctatcgcaacaatgttgtcaacaccatgcgcctctggtctgccaag
gctcccaatgacttcaacctcaaggacttcaatgtcggtggctacatccaggctgtgttg
gaccgaaacctggcggagaacatctctcgtgtcctgtaccccaatgataatttcttcgaa
gggaaggagctgcggctgaagcaggagtatttcgtggtggctgccaccctccaggacatc
atccgtcgcttcaagtcttccaagttcggctgccgtgatcccgtgcgcacgaacttcgat
gccttcccagataaggtggccatccagctcaatgacacccacccctccctggccatcccc
gagctgatgaggatcctggtggacctggaacggatggactgggacaaggcgtgggatgtg
acagtgaggacctgtgcctacaccaaccacacggtgctgcccgaggccctggagcgctgg
ccggtgcacctcttggagacgctgctgccgcggcacctccagatcatctacgagatcaac
cagcgcttcctcaaccgggtggcggccgcattcccaggggacgtagaccggctgcggcgc
atgtcgctggtggaggagggcgcagtgaagcgcatcaacatggcacacctgtgcatcgcg
gggtcgcacgccgtcaacggcgtggcgcgcatccactccgagatcctcaagaagaccatc
ttcaaagacttctatgagctggagcctcataagttccagaataagaccaacggcatcacc
cctcggcgctggctggttctgtgtaaccccgggctggcagaggtcattgctgagcgcatc
ggggaggacttcatctctgacctggaccagctgcgcaaactgctctcctttgtggatgat
gaagctttcattcgggatgtggccaaagtgaagcaggaaaacaagttgaagtttgctgcc
tacctagagagggaatacaaagtccacatcaaccccaactcactcttcgacatccaggtg
aagcggattcacgaatataaacgacagctcctcaactgcctccatgtcatcaccctgtac
aaccgcatcaagagggagcccaataagttttttgtgcctcggactgtgatgattggaggg
aaggctgcacctgggtaccacatggccaagatgatcatcagactcgtcacagccatcggg
gatgtggtcaaccatgacccggcagtgggtgaccgcctccgtgtcatcttcctggagaac
taccgagtctcactggccgagaaagtgatcccagctgcagacctctctgagcagatctcc
actgcgggcactgaagcctcaggcaccggcaacatgaagttcatgctcaacggggctctg
accattggcaccatggacggggccaatgtggagatggcagaagaggcgggagaggaaaac
ttcttcatctttggcatgcgggtggaggatgtggataagcttgaccaaagagggtacaat
gcccaggagtactacgatcgcattcctgagcttcggcaggtcattgagcagctgagcagt
ggcttcttctcccccaaacagcccgacctgttcaaggacattgtcaatatgctcatgcac
catgaccggtttaaagtcttcgcagattatgaagactacattaaatgccaggagaaagtc
agcgccttgtacaagaacccaagagagtggacgcggatggtgatccggaacatagccacc
tctggcaagttctccagtgaccgcaccattgcccagtatgcccgggagatctggggtgtg
gagccttcccgccagcgcctgccagccccggatgaggccatctga

DBGET integrated database retrieval system