KEGG   Homo sapiens (human): 590Help
Entry
590               CDS       T01001                                 

Gene name
BCHE, CHE1, CHE2, E1
Definition
butyrylcholinesterase (EC:3.1.1.8)
Orthology
K01050  
cholinesterase [EC:3.1.1.8]
Organism
hsa  Homo sapiens (human)
Drug target
Rivastigmine: 
Fluostigmine: 
Other: 
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q26.1-q26.2
AA seq 602 aa AA seqDB search
MHSKVTIICIRFLFWFLLLCMLIGKSHTEDDIIIATKNGKVRGMNLTVFGGTVTAFLGIP
YAQPPLGRLRFKKPQSLTKWSDIWNATKYANSCCQNIDQSFPGFHGSEMWNPNTDLSEDC
LYLNVWIPAPKPKNATVLIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRVGALG
FLALPGNPEAPGNMGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPG
SHSLFTRAILQSGSFNAPWAVTSLYEARNRTLNLAKLTGCSRENETEIIKCLRNKDPQEI
LLNEAFVVPYGTPLSVNFGPTVDGDFLTDMPDILLELGQFKKTQILVGVNKDEGTAFLVY
GAPGFSKDNNSIITRKEFQEGLKIFFPGVSEFGKESILFHYTDWVDDQRPENYREALGDV
VGDYNFICPALEFTKKFSEWGNNAFFYYFEHRSSKLPWPEWMGVMHGYEIEFVFGLPLER
RDNYTKAEEILSRSIVKRWANFAKYGNPNETQNNSTSWPVFKSTEQKYLTLNTESTRIMT
KLRAQQCRFWTSFFPKVLEMTGNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCV
GL
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgcatagcaaagtcacaatcatatgcatcagatttctcttttggtttcttttgctctgc
atgcttattgggaagtcacatactgaagatgacatcataattgcaacaaagaatggaaaa
gtcagagggatgaacttgacagtttttggtggcacggtaacagcctttcttggaattccc
tatgcacagccacctcttggtagacttcgattcaaaaagccacagtctctgaccaagtgg
tctgatatttggaatgccacaaaatatgcaaattcttgctgtcagaacatagatcaaagt
tttccaggcttccatggatcagagatgtggaacccaaacactgacctcagtgaagactgt
ttatatctaaatgtatggattccagcacctaaaccaaaaaatgccactgtattgatatgg
atttatggtggtggttttcaaactggaacatcatctttacatgtttatgatggcaagttt
ctggctcgggttgaaagagttattgtagtgtcaatgaactatagggtgggtgccctagga
ttcttagctttgccaggaaatcctgaggctccagggaacatgggtttatttgatcaacag
ttggctcttcagtgggttcaaaaaaatatagcagcctttggtggaaatcctaaaagtgta
actctctttggagaaagtgcaggagcagcttcagttagcctgcatttgctttctcctgga
agccattcattgttcaccagagccattctgcaaagtggatcctttaatgctccttgggcg
gtaacatctctttatgaagctaggaacagaacgttgaacttagctaaattgactggttgc
tctagagagaatgagactgaaataatcaagtgtcttagaaataaagatccccaagaaatt
cttctgaatgaagcatttgttgtcccctatgggactcctttgtcagtaaactttggtccg
accgtggatggtgattttctcactgacatgccagacatattacttgaacttggacaattt
aaaaaaacccagattttggtgggtgttaataaagatgaagggacagcttttttagtctat
ggtgctcctggcttcagcaaagataacaatagtatcataactagaaaagaatttcaggaa
ggtttaaaaatattttttccaggagtgagtgagtttggaaaggaatccatcctttttcat
tacacagactgggtagatgatcagagacctgaaaactaccgtgaggccttgggtgatgtt
gttggggattataatttcatatgccctgccttggagttcaccaagaagttctcagaatgg
ggaaataatgcctttttctactattttgaacaccgatcctccaaacttccgtggccagaa
tggatgggagtgatgcatggctatgaaattgaatttgtctttggtttacctctggaaaga
agagataattacacaaaagccgaggaaattttgagtagatccatagtgaaacggtgggca
aattttgcaaaatatgggaatccaaatgagactcagaacaatagcacaagctggcctgtc
ttcaaaagcactgaacaaaaatatctaaccttgaatacagagtcaacaagaataatgacg
aaactacgtgctcaacaatgtcgattctggacatcattttttccaaaagtcttggaaatg
acaggaaatattgatgaagcagaatgggagtggaaagcaggattccatcgctggaacaat
tacatgatggactggaaaaatcaatttaacgattacactagcaagaaagaaagttgtgtg
ggtctctaa

DBGET integrated database retrieval system