KEGG   Homo sapiens (human): 5913Help
Entry
5913              CDS       T01001                                 

Gene name
RAPSN, RAPSYN, RNF205
Definition
receptor-associated protein of the synapse
Organism
hsa  Homo sapiens (human)
Disease
H00770  
Congenital myasthenic syndrome
H00987  
Fetal akinesia deformation sequence (FADS)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p11.2
AA seq 412 aa AA seqDB search
MGQDQTKQQIEKGLQLYQSNQTEKALQVWTKVLEKSSDLMGRFRVLGCLVTAHSEMGRYK
EMLKFAVVQIDTARELEDADFLLESYLNLARSNEKLCEFHKTISYCKTCLGLPGTRAGAQ
LGGQVSLSMGNAFLGLSVFQKALESFEKALRYAHNNDDAMLECRVCCSLGSFYAQVKDYE
KALFFPCKAAELVNNYGKGWSLKYRAMSQYHMAVAYRLLGRLGSAMECCEESMKIALQHG
DRPLQALCLLCFADIHRSRGDLETAFPRYDSAMSIMTEIGNRLGQVQALLGVAKCWVARK
ALDKALDAIERAQDLAEEVGNKLSQLKLHCLSESIYRSKGLQRELRAHVVRFHECVEETE
LYCGLCGESIGEKNSRLQALPCSHIFHLRCLQNNGTRSCPNCRRSSMKPGFV
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggggcaggaccagaccaagcagcagatcgagaaggggctccagctgtaccagtccaac
cagacagagaaggcattgcaggtgtggacaaaggtgctggagaagagctcggacctcatg
gggcgcttccgcgtgctgggctgcctggtcacagcccactcggagatgggccgctacaag
gagatgctgaagttcgctgtggtccagatcgacacggcccgggagctggaggatgccgac
ttcctcctggagagctacctgaacctggcacgcagcaacgagaagctgtgcgagtttcac
aagaccatctcctactgcaagacctgccttgggctgcctggtaccagggcaggtgcccag
ctcggaggccaggtcagcctgagcatgggcaatgccttcctgggcctcagcgtcttccag
aaggccctggagagcttcgagaaggccctgcgctatgcccacaacaatgatgacgccatg
ctcgagtgccgcgtgtgctgcagcctgggcagcttctatgcccaggtcaaggactacgag
aaagccctgttcttcccctgcaaggcggcagagcttgtcaacaactatggcaaaggctgg
agcctgaagtaccgggccatgagccagtaccacatggccgtggcctatcgcctgctgggc
cgcctgggcagtgccatggagtgttgtgaggagtctatgaagatcgcgctgcagcacggg
gaccggccactgcaggcgctctgcctgctctgcttcgctgacatccaccggagccgtggg
gacctggagacagccttccccaggtacgactccgccatgagcatcatgaccgagatcgga
aaccgcctggggcaggtgcaggcgctgctgggtgtggccaagtgctgggtggccaggaag
gcgctggacaaggctctggatgccatcgagagagcccaggatctggccgaggaggtgggg
aacaagctgagccagctcaagctgcactgtctgagcgagagcatttaccgcagcaaaggg
ctgcagcgggaactgcgggcgcacgttgtgaggttccacgagtgcgtggaggagacggag
ctctactgcggcctgtgcggcgagtccataggcgagaagaacagccggctgcaggcccta
ccttgctcccacatcttccacctcaggtgcctgcagaacaacgggacccggagctgtccc
aactgccgccgctcatccatgaagcctggctttgtatga

DBGET integrated database retrieval system