KEGG   Homo sapiens (human): 596Help
Entry
596               CDS       T01001                                 

Gene name
BCL2, Bcl-2, PPP1R50
Definition
B-cell CLL/lymphoma 2
Orthology
K02161  
apoptosis regulator BCL-2
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
HIF-1 signaling pathway
Protein processing in endoplasmic reticulum
PI3K-Akt signaling pathway
Apoptosis
Adrenergic signaling in cardiomyocytes
Focal adhesion
Neurotrophin signaling pathway
Cholinergic synapse
Amyotrophic lateral sclerosis (ALS)
Toxoplasmosis
Tuberculosis
Hepatitis B
Epstein-Barr virus infection
Pathways in cancer
MicroRNAs in cancer
Colorectal cancer
Prostate cancer
Small cell lung cancer
Disease
H00005  
Chronic lymphocytic leukemia (CLL)
H00013  
Small cell lung cancer
H00018  
Gastric cancer
H00028  
Choriocarcinoma
H00030  
Cervical cancer
H00041  
Kaposi's sarcoma
H00054  
Nasopharyngeal cancer
Drug target
Oblimersen: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    596 (BCL2)
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    596 (BCL2)
   04066 HIF-1 signaling pathway
    596 (BCL2)
   04151 PI3K-Akt signaling pathway
    596 (BCL2)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    596 (BCL2)
  Cellular commiunity
   04510 Focal adhesion
    596 (BCL2)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    596 (BCL2)
  Nervous system
   04725 Cholinergic synapse
    596 (BCL2)
   04722 Neurotrophin signaling pathway
    596 (BCL2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    596 (BCL2)
   05206 MicroRNAs in cancer
    596 (BCL2)
   05210 Colorectal cancer
    596 (BCL2)
   05215 Prostate cancer
    596 (BCL2)
   05222 Small cell lung cancer
    596 (BCL2)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    596 (BCL2)
  Infectious diseases
   05152 Tuberculosis
    596 (BCL2)
   05161 Hepatitis B
    596 (BCL2)
   05169 Epstein-Barr virus infection
    596 (BCL2)
   05145 Toxoplasmosis
    596 (BCL2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     596 (BCL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
18q21.3
AA seq 239 aa AA seqDB search
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacgctgggagaacagggtacgataaccgggagatagtgatgaagtacatccat
tataagctgtcgcagaggggctacgagtgggatgcgggagatgtgggcgccgcgcccccg
ggggccgcccccgcaccgggcatcttctcctcccagcccgggcacacgccccatccagcc
gcatcccgggacccggtcgccaggacctcgccgctgcagaccccggctgcccccggcgcc
gccgcggggcctgcgctcagcccggtgccacctgtggtccacctgaccctccgccaggcc
ggcgacgacttctcccgccgctaccgccgcgacttcgccgagatgtccagccagctgcac
ctgacgcccttcaccgcgcggggacgctttgccacggtggtggaggagctcttcagggac
ggggtgaactgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggag
agcgtcaaccgggagatgtcgcccctggtggacaacatcgccctgtggatgactgagtac
ctgaaccggcacctgcacacctggatccaggataacggaggctgggatgcctttgtggaa
ctgtacggccccagcatgcggcctctgtttgatttctcctggctgtctctgaagactctg
ctcagtttggccctggtgggagcttgcatcaccctgggtgcctatctgggccacaagtga

DBGET integrated database retrieval system