KEGG   Homo sapiens (human): 60386Help
Entry
60386             CDS       T01001                                 

Gene name
SLC25A19, DNC, MCPHA, MUP1, THMD3, THMD4, TPC
Definition
solute carrier family 25 (mitochondrial thiamine pyrophosphate carrier), member 19
Orthology
K15108  
solute carrier family 25 (mitochondrial thiamine pyrophosphate transporter), member 19
Organism
hsa  Homo sapiens (human)
Disease
H00990  
Microcephaly, Amish type
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q25.3
AA seq 320 aa AA seqDB search
MVGYDPKPDGRNNTKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHERLSRSDPSAKYH
GILQASRQILQEEGPTAFWKGHVPAQILSIGYGAVQFLSFEMLTELVHRGSVYDAREFSV
HFVCGGLAACMATLTVHPVDVLRTRFAAQGEPKVYNTLRHAVGTMYRSEGPQVFYKGLAP
TLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKKNENLQNLLCGSGAGVISKTLTYPLDLF
KKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKGLSPSLLKAALSTGFMF
FSYEFFCNVFHCMNRTASQR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggttggctatgaccccaaaccagatggcaggaataacaccaagttccaggtggcagtg
gctgggtctgtgtctggacttgttactcgggcgctgatcagtcccttcgacgtcatcaag
atccgtttccagcttcagcatgagcgcctgtctcgcagtgaccccagcgcaaagtaccat
ggcatcctccaggcctctaggcagattctgcaggaggagggtccgacagctttctggaaa
ggacacgtcccagctcagattctctccataggctatggagctgtccaattcttgtcattt
gaaatgctgacggagctggtccacagaggcagcgtgtatgacgcccgggaattctcagtg
cactttgtatgtggtggcctggctgcctgtatggccaccctcactgtgcaccccgtggat
gttctgcgcacccgctttgcagctcagggtgagcccaaggtctataatacgctgcgccac
gccgtggggaccatgtataggagcgaaggcccccaggttttctacaaaggcttggctccc
accttgatcgccatcttcccctacgccgggctgcagttctcttgctacagctccttgaag
cacctgtacaagtgggccataccagccgaaggaaagaaaaatgagaacctccaaaacctg
ctttgtggcagtggagctggtgtcatcagcaagaccctgacatatccgctggacctcttc
aagaagcggctacaggttggagggtttgagcatgccagagctgcctttggccaggtacgg
agatacaagggcctcatggactgtgccaagcaggtgctgcaaaaggaaggcgccctgggc
ttcttcaagggcctgtcccccagcttgctgaaggctgccctctccacaggcttcatgttc
ttctcgtatgaattcttctgtaatgtcttccactgcatgaacaggacagccagccagcgc
tga

DBGET integrated database retrieval system