KEGG   Homo sapiens (human): 6102Help
Entry
6102              CDS       T01001                                 

Gene name
RP2, DELXp11.3, NM23-H10, NME10, TBCCD2, XRP2
Definition
retinitis pigmentosa 2 (X-linked recessive)
Organism
hsa  Homo sapiens (human)
Disease
H00527  
Retinitis pigmentosa (RP)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp11.3
AA seq 350 aa AA seqDB search
MGCFFSKRRKADKESRPENEEERPKQYSWDQREKVDPKDYMFSGLKDETVGRLPGTVAGQ
QFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVR
DCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPV
SGELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVL
FAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIAL
EFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGI
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcttcttctccaagagacggaaggctgacaaggagtcgcggcccgagaacgag
gaggagcggccaaagcagtacagctgggatcagcgcgagaaggttgatccaaaagactac
atgttcagtggactgaaggatgaaacagtaggtcgcttacctgggacggtagcaggacaa
cagtttctcattcaagactgtgagaactgtaacatctatatttttgatcactctgctaca
gttaccattgatgactgtactaactgcataatttttctgggacccgtgaaaggcagcgtg
tttttccggaattgcagagattgcaagtgcacattagcctgccaacaatttcgtgtgcga
gattgtagaaagctggaagtctttttgtgttgtgccactcaacccatcattgagtcttcc
tcaaatatcaaatttggatgttttcaatggtactatcctgaattagctttccagttcaaa
gatgcagggctaagtatcttcaacaatacatggagtaacattcatgactttacacctgtg
tcaggagaactcaactggagccttcttccagaagatgctgtggttcaggactatgttcct
atacctactaccgaagagctcaaagctgttcgtgtttccacagaagccaatagaagcatt
gttccaatatcccggggtcagagacagaagagcagcgatgaatcatgcttagtggtatta
tttgctggtgattacactattgcaaatgccagaaaactaattgatgagatggttggtaaa
ggctttttcctagttcagacaaaggaagtgtccatgaaagctgaggatgctcaaagggtt
tttcgggaaaaagcacctgacttccttcctcttctgaacaaaggtcctgttattgccttg
gagtttaatggggatggtgctgtagaagtatgtcaacttattgtaaacgagatattcaat
gggaccaagatgtttgtatctgaaagcaaggagacggcatctggagatgtagacagcttc
tacaactttgctgatatacagatgggaatatga

DBGET integrated database retrieval system