KEGG   Homo sapiens (human): 6121Help
Entry
6121              CDS       T01001                                 

Gene name
RPE65, BCO3, LCA2, RP20, mRPE65, rd12, sRPE65
Definition
retinal pigment epithelium-specific protein 65kDa (EC:3.1.1.64)
Orthology
K11158  
retinoid isomerohydrolase [EC:3.1.1.64]
Organism
hsa  Homo sapiens (human)
Pathway
Retinol metabolism
Disease
H00527  
Retinitis pigmentosa (RP)
H00837  
Leber congenital amaurosis (LCR)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    6121 (RPE65)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.64  retinoid isomerohydrolase
     6121 (RPE65)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p31
AA seq 533 aa AA seqDB search
MSIQVEHPAGGYKKLFETVEELSSPLTAHVTGRIPLWLTGSLLRCGPGLFEVGSEPFYHL
FDGQALLHKFDFKEGHVTYHRRFIRTDAYVRAMTEKRIVITEFGTCAFPDPCKNIFSRFF
SYFRGVEVTDNALVNVYPVGEDYYACTETNFITKINPETLETIKQVDLCNYVSVNGATAH
PHIENDGTVYNIGNCFGKNFSIAYNIVKIPPLQADKEDPISKSEIVVQFPCSDRFKPSYV
HSFGLTPNYIVFVETPVKINLFKFLSSWSLWGANYMDCFESNETMGVWLHIADKKRKKYL
NNKYRTSPFNLFHHINTYEDNGFLIVDLCCWKGFEFVYNYLYLANLRENWEEVKKNARKA
PQPEVRRYVLPLNIDKADTGKNLVTLPNTTATAILCSDETIWLEPEVLFSGPRQAFEFPQ
INYQKYCGKPYTYAYGLGLNHFVPDRLCKLNVKTKETWVWQEPDSYPSEPIFVSHPDALE
EDDGVVLSVVVSPGAGQKPAYLLILNAKDLSEVARAEVEINIPVTFHGLFKKS
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgtctatccaggttgagcatcctgctggtggttacaagaaactgtttgaaactgtggag
gaactgtcctcgccgctcacagctcatgtaacaggcaggatccccctctggctcaccggc
agtctccttcgatgtgggccaggactctttgaagttggatctgagccattttaccacctg
tttgatgggcaagccctcctgcacaagtttgactttaaagaaggacatgtcacataccac
agaaggttcatccgcactgatgcttacgtacgggcaatgactgagaaaaggatcgtcata
acagaatttggcacctgtgctttcccagatccctgcaagaatatattttccaggtttttt
tcttactttcgaggagtagaggttactgacaatgcccttgttaatgtctacccagtgggg
gaagattactacgcttgcacagagaccaactttattacaaagattaatccagagaccttg
gagacaattaagcaggttgatctttgcaactatgtctctgtcaatggggccactgctcac
ccccacattgaaaatgatggaaccgtttacaatattggtaattgctttggaaaaaatttt
tcaattgcctacaacattgtaaagatcccaccactgcaagcagacaaggaagatccaata
agcaagtcagagatcgttgtacaattcccctgcagtgaccgattcaagccatcttacgtt
catagttttggtctgactcccaactatatcgtttttgtggagacaccagtcaaaattaac
ctgttcaagttcctttcttcatggagtctttggggagccaactacatggattgttttgag
tccaatgaaaccatgggggtttggcttcatattgctgacaaaaaaaggaaaaagtacctc
aataataaatacagaacttctcctttcaacctcttccatcacatcaacacctatgaagac
aatgggtttctgattgtggatctctgctgctggaaaggatttgagtttgtttataattac
ttatatttagccaatttacgtgagaactgggaagaggtgaaaaaaaatgccagaaaggct
ccccaacctgaagttaggagatatgtacttcctttgaatattgacaaggctgacacaggc
aagaatttagtcacgctccccaatacaactgccactgcaattctgtgcagtgacgagact
atctggctggagcctgaagttctcttttcagggcctcgtcaagcatttgagtttcctcaa
atcaattaccagaagtattgtgggaaaccttacacatatgcgtatggacttggcttgaat
cactttgttccagataggctctgtaagctgaatgtcaaaactaaagaaacttgggtttgg
caagagcctgattcatacccatcagaacccatctttgtttctcacccagatgccttggaa
gaagatgatggtgtagttctgagtgtggtggtgagcccaggagcaggacaaaagcctgct
tatctcctgattctgaatgccaaggacttaagtgaagttgcccgggctgaagtggagatt
aacatccctgtcacctttcatggactgttcaaaaaatcttga

DBGET integrated database retrieval system