KEGG   Homo sapiens (human): 6233Help
Entry
6233              CDS       T01001                                 

Gene name
RPS27A, CEP80, HEL112, S27A, UBA80, UBC, UBCEP1, UBCEP80
Definition
(RefSeq) ribosomal protein S27a
  KO
K02977  
small subunit ribosomal protein S27Ae
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome
Module
Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    6233 (RPS27A)
Ribosome [BR:hsa03011]
 Ribosomal Proteins
  Eukaryotes
   Small subunit
    6233 (RPS27A)
  Archaea
    6233 (RPS27A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   6233 (RPS27A)
  Exosomal proteins of colorectal cancer cells
   6233 (RPS27A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 
4XOF 3NHE 5DK8 1OGW 4IUM 1XD3 4PIH 4PIJ 4UN2 4ZPZ 5J8P 3BY4 2GBM 2ZCB 2GBN 5AF5 4I6N 3VUX 3V6C 3PRP 3NS8 4K7S 4K7U 4K7W 3N32 3ONS 3K9O 1UBI 1UBQ 3EHV 3EFU 5AF4 3ALB 3MHS 5CVM 4WZP 4LDT 3H7P 5D0M 3TMP 4PIG 3VUW 2JF5 3HM3 3VUY 2GBK 2G45 4WLR 4IG7 3PHW 2GBR 1S1Q 4FJV 5JBV 5DFL 3V6E 4RF1 3NOB 5IFR 4XOK 2XEW 3A33 2O6V 2IBI 5AIU 4R62 4UEL 3ZNH 3PRM 3H7S 2WDT 1NBF 3C0R 4BOS 4DHJ 3UGB 3OFI 3AUL 3IFW 1TBE 5BNB 3RUL 3PT2 3OJ3 2GMI 3I3T 3DVG 2OJR 5CAW 5CRA 5D0K 4BVU 3PTF 3O65 3MTN 3JSV 3DVN 2HTH 1F9J 4MM3 4RF0 3VFK 3KVF 3K9P 3IHP 3KW5 4HXD 4JQW 3ZLZ 3TBL 4XOL 3PHD 2XK5 3N30 3EEC 4S1Z 4BOZ 4LCD 4DHZ 4WUR 4DDG 5CVN 5AF6 3OJ4 5EDV 2AYO 4JIO 4UF6 4DDI 4ZUX 5CVO 5A2Q 4WHV 5A5B 2NBD 2NBE 2N3U 2N3V 2N3W 2N2K 2N13 2MWS 2MUR 2MSG 2MRO 2MRE 2MOR 2MJB 2MJ5 2RU6 2MCN 2MBQ 2MBO 2MBH 2MBB 2LZ6 2LVO 2LVP 2LVQ 2RSU 2LJ5 2L3Z 2L0T 2L0F 2RR9 2KWV 2KWU 2KTF 2KOX 2KN5 2KLG 2KJH 2KHW 2KDF 2K8B 2K8C 2K6D 2JZZ 2JY6 2Z59 2JRI 2PE9 2PEA 2NR2 2J7Q 2DEN 1ZGU 1YX5 1YX6 2BGF 1XQQ 1Q5W 1G6J 1FXT 1D3Z
Thumbnails

Jmol
Position
2p16
AA seq 156 aa AA seqDB search
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRE
CPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgcagattttcgtgaaaacccttacggggaagaccatcaccctcgaggttgaaccctcg
gatacgatagaaaatgtaaaggccaagatccaggataaggaaggaattcctcctgatcag
cagagactgatctttgctggcaagcagctggaagatggacgtactttgtctgactacaat
attcaaaaggagtctactcttcatcttgtgttgagacttcgtggtggtgctaagaaaagg
aagaagaagtcttacaccactcccaagaagaataagcacaagagaaagaaggttaagctg
gctgtcctgaaatattataaggtggatgagaatggcaaaattagtcgccttcgtcgagag
tgcccttctgatgaatgtggtgctggggtgtttatggcaagtcactttgacagacattat
tgtggcaaatgttgtctgacttactgtttcaacaaaccagaagacaagtaa

DBGET integrated database retrieval system