KEGG   Homo sapiens (human): 6288Help
Entry
6288              CDS       T01001                                 

Gene name
SAA1, PIG4, SAA, SAA2, TP53I4
Definition
serum amyloid A1
Orthology
K17310  
serum amyloid A protein
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p15.1
AA seq 122 aa AA seqDB search
MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNY
DAAKRGPGGAWAAEVISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPE
KY
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttctcacgggcctggttttctgctccttggtcctgggtgtcagcagccgaagc
ttcttttcgttccttggcgaggcttttgatggggctcgggacatgtggagagcctactct
gacatgagagaagccaattacatcggctcagacaaatacttccatgctcgggggaactat
gatgctgccaaaaggggacctgggggtgcctgggctgcagaagtgatcagcgatgccaga
gagaatatccagagattctttggccatggtgcggaggactcgctggctgatcaggctgcc
aatgaatggggcaggagtggcaaagaccccaatcacttccgacctgctggcctgcctgag
aaatactga

DBGET integrated database retrieval system