KEGG   Homo sapiens (human): 6336Help
Entry
6336              CDS       T01001                                 

Gene name
SCN10A, FEPS2, Nav1.8, PN3, SNS, hPN3
Definition
(RefSeq) sodium voltage-gated channel alpha subunit 10
  KO
K04842  
voltage-gated sodium channel type X alpha
Organism
hsa  Homo sapiens (human)
Disease
H01391  
Familial episodic pain syndrome (FEPS)
Drug target
Lidocaine [DG:DG00196]: 
Tetracaine [DG:DG00296]: 
Benzocaine: 
Cinchocaine [DG:DG00297]: 
Procaine [DG:DG00298]: 
Aminobenzoic acid [DG:DG00379]: 
Chloroprocaine [DG:DG00800]: 
Bupivacaine [DG:DG00801]: 
Mepivacaine [DG:DG00802]: 
Prilocaine [DG:DG00803]: 
Ropivacaine [DG:DG00806]: 
Levobupivacaine [DG:DG00807]: 
Cocaine [DG:DG00808]: 
Dyclonine [DG:DG00809]: 
Proxymetacaine [DG:DG01145]: 
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Na+ channel, SCN alpha, NaV1.x
   6336 (SCN10A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p22.2
AA seq 1956 aa AA seqDB search
MEFPIGSLETNNFRRFTPESLVEIEKQIAAKQGTKKAREKHREQKDQEEKPRPQLDLKAC
NQLPKFYGELPAELIGEPLEDLDPFYSTHRTFMVLNKGRTISRFSATRALWLFSPFNLIR
RTAIKVSVHSWFSLFITVTILVNCVCMTRTDLPEKIEYVFTVIYTFEALIKILARGFCLN
EFTYLRDPWNWLDFSVITLAYVGTAIDLRGISGLRTFRVLRALKTVSVIPGLKVIVGALI
HSVKKLADVTILTIFCLSVFALVGLQLFKGNLKNKCVKNDMAVNETTNYSSHRKPDIYIN
KRGTSDPLLCGNGSDSGHCPDGYICLKTSDNPDFNYTSFDSFAWAFLSLFRLMTQDSWER
LYQQTLRTSGKIYMIFFVLVIFLGSFYLVNLILAVVTMAYEEQNQATTDEIEAKEKKFQE
ALEMLRKEQEVLAALGIDTTSLHSHNGSPLTSKNASERRHRIKPRVSEGSTEDNKSPRSD
PYNQRRMSFLGLASGKRRASHGSVFHFRSPGRDISLPEGVTDDGVFPGDHESHRGSLLLG
GGAGQQGPLPRSPLPQPSNPDSRHGEDEHQPPPTSELAPGAVDVSAFDAGQKKTFLSAEY
LDEPFRAQRAMSVVSIITSVLEELEESEQKCPPCLTSLSQKYLIWDCCPMWVKLKTILFG
LVTDPFAELTITLCIVVNTIFMAMEHHGMSPTFEAMLQIGNIVFTIFFTAEMVFKIIAFD
PYYYFQKKWNIFDCIIVTVSLLELGVAKKGSLSVLRSFRLLRVFKLAKSWPTLNTLIKII
GNSVGALGNLTIILAIIVFVFALVGKQLLGENYRNNRKNISAPHEDWPRWHMHDFFHSFL
IVFRILCGEWIENMWACMEVGQKSICLILFLTVMVLGNLVVLNLFIALLLNSFSADNLTA
PEDDGEVNNLQVALARIQVFGHRTKQALCSFFSRSCPFPQPKAEPELVVKLPLSSSKAEN
HIAANTARGSSGGLQAPRGPRDEHSDFIANPTVWVSVPIAEGESDLDDLEDDGGEDAQSF
QQEVIPKGQQEQLQQVERCGDHLTPRSPGTGTSSEDLAPSLGETWKDESVPQVPAEGVDD
TSSSEGSTVDCLDPEEILRKIPELADDLEEPDDCFTEGCIRHCPCCKLDTTKSPWDVGWQ
VRKTCYRIVEHSWFESFIIFMILLSSGSLAFEDYYLDQKPTVKALLEYTDRVFTFIFVFE
MLLKWVAYGFKKYFTNAWCWLDFLIVNISLISLTAKILEYSEVAPIKALRTLRALRPLRA
LSRFEGMRVVVDALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFWRCINYTDGEFSL
VPLSIVNNKSDCKIQNSTGSFFWVNVKVNFDNVAMGYLALLQVATFKGWMDIMYAAVDSR
EVNMQPKWEDNVYMYLYFVIFIIFGGFFTLNLFVGVIIDNFNQQKKKLGGQDIFMTEEQK
KYYNAMKKLGSKKPQKPIPRPLNKFQGFVFDIVTRQAFDITIMVLICLNMITMMVETDDQ
SEEKTKILGKINQFFVAVFTGECVMKMFALRQYYFTNGWNVFDFIVVVLSIASLIFSAIL
KSLQSYFSPTLFRVIRLARIGRILRLIRAAKGIRTLLFALMMSLPALFNIGLLLFLVMFI
YSIFGMSSFPHVRWEAGIDDMFNFQTFANSMLCLFQITTSAGWDGLLSPILNTGPPYCDP
NLPNSNGTRGDCGSPAVGIIFFTTYIIISFLIVVNMYIAVILENFNVATEESTEPLSEDD
FDMFYETWEKFDPEATQFITFSALSDFADTLSGPLRIPKPNRNILIQMDLPLVPGDKIHC
LDILFAFTKNVLGESGELDSLKANMEEKFMATNLSKSSYEPIATTLRWKQEDISATVIQK
AYRSYVLHRSMALSNTPCVPRAEEEAASLPDEGFVAFTANENCVLPDKSETASATSFPPS
YESVTRGLSDRVNMRTSSSIQNEDEATSMELIAPGP
NT seq 5871 nt NT seq  +upstreamnt  +downstreamnt
atggaattccccattggatccctcgaaactaacaacttccgtcgctttactccggagtca
ctggtggagatagagaagcaaattgctgccaagcagggaacaaagaaagccagagagaag
catagggagcagaaggaccaagaagagaagcctcggccccagctggacttgaaagcctgc
aaccagctgcccaagttctatggtgagctcccagcagaactgatcggggagcccctggag
gatctagatccgttctacagcacacaccggacatttatggtgctgaacaaagggaggacc
atttcccggtttagtgccactcgggccctgtggctattcagtcctttcaacctgatcaga
agaacggccatcaaagtgtctgtccactcgtggttcagtttatttattacggtcactatt
ttggttaattgtgtgtgcatgacccgaactgaccttccagagaaaattgaatatgtcttc
actgtcatttacacctttgaagccttgataaagatactggcaagaggattttgtctaaat
gagttcacgtacctgagagatccttggaactggctggattttagcgtcattaccctggca
tatgttggcacagcaatagatctccgtgggatctcaggcctgcggacattcagagttctt
agagcattaaaaacagtttctgtgatcccaggcctgaaggtcattgtgggggccctgatt
cactcagtgaagaaactggctgatgtgaccatcctcaccatcttctgcctaagtgttttt
gccttggtggggctgcaactcttcaagggcaacctcaaaaataaatgtgtcaagaatgac
atggctgtcaatgagacaaccaactactcatctcacagaaaaccagatatctacataaat
aagcgaggcacttctgaccccttactgtgtggcaatggatctgactcaggccactgccct
gatggttatatctgccttaaaacttctgacaacccggattttaactacaccagctttgat
tcctttgcttgggctttcctctcactgttccgcctcatgacacaggattcctgggaacgc
ctctaccagcagaccctgaggacttctgggaaaatctatatgatcttttttgtgctcgta
atcttcctgggatctttctacctggtcaacttgatcttggctgtagtcaccatggcgtat
gaggagcagaaccaggcaaccactgatgaaattgaagcaaaggagaagaagttccaggag
gccctcgagatgctccggaaggagcaggaggtgctagcagcactagggattgacacaacc
tctctccactcccacaatggatcacctttaacctccaaaaatgccagtgagagaaggcat
agaataaagccaagagtgtcagagggctccacagaagacaacaaatcaccccgctctgat
ccttacaaccagcgcaggatgtcttttctaggcctcgcctctggaaaacgccgggctagt
catggcagtgtgttccatttccggtcccctggccgagatatctcactccctgagggagtc
acagatgatggagtctttcctggagaccacgaaagccatcggggctctctgctgctgggt
gggggtgctggccagcaaggccccctccctagaagccctcttcctcaacccagcaaccct
gactccaggcatggagaagatgaacaccaaccgccgcccactagtgagcttgcccctgga
gctgtcgatgtctcggcattcgatgcaggacaaaagaagactttcttgtcagcagaatac
ttagatgaacctttccgggcccaaagggcaatgagtgttgtcagtatcataacctccgtc
cttgaggaactcgaggagtctgaacagaagtgcccaccctgcttgaccagcttgtctcag
aagtatctgatctgggattgctgccccatgtgggtgaagctcaagacaattctctttggg
cttgtgacggatccctttgcagagctcaccatcaccttgtgcatcgtggtgaacaccatc
ttcatggccatggagcaccatggcatgagccctaccttcgaagccatgctccagataggc
aacatcgtctttaccatattttttactgctgaaatggtcttcaaaatcattgccttcgac
ccatactattatttccagaagaagtggaatatctttgactgcatcatcgtcactgtgagt
ctgctagagctgggcgtggccaagaagggaagcctgtctgtgctgcggagcttccgcttg
ctgcgcgtattcaagctggccaaatcctggcccaccttaaacacactcatcaagatcatc
ggaaactcagtgggggcactggggaacctcaccatcatcctggccatcattgtctttgtc
tttgctctggttggcaagcagctcctaggggaaaactaccgtaacaaccgaaaaaatatc
tccgcgccccatgaagactggccccgctggcacatgcacgacttcttccactctttcctc
attgtcttccgtatcctctgtggagagtggattgagaacatgtgggcctgcatggaagtt
ggccaaaaatccatatgcctcatccttttcttgacggtgatggtgctagggaacctggtg
gtgcttaacctgttcatcgccctgctattgaactctttcagtgctgacaacctcacagcc
ccggaggacgatggggaggtgaacaacctgcaggtggccctggcacggatccaggtcttt
ggccatcgtaccaaacaggctctttgcagcttcttcagcaggtcctgcccattcccccag
cccaaggcagagcctgagctggtggtgaaactcccactctccagctccaaggctgagaac
cacattgctgccaacactgccagggggagctctggagggctccaagctcccagaggcccc
agggatgagcacagtgacttcatcgctaatccgactgtgtgggtctctgtgcccattgct
gagggtgaatctgatcttgatgacttggaggatgatggtggggaagatgctcagagcttc
cagcaggaagtgatccccaaaggacagcaggagcagctgcagcaagtcgagaggtgtggg
gaccacctgacacccaggagcccaggcactggaacatcttctgaggacctggctccatcc
ctgggtgagacgtggaaagatgagtctgttcctcaggtccctgctgagggagtggacgac
acaagctcctctgagggcagcacggtggactgcctagatcctgaggaaatcctgaggaag
atccctgagctggcagatgacctggaagaaccagatgactgcttcacagaaggatgcatt
cgccactgtccctgctgcaaactggataccaccaagagtccatgggatgtgggctggcag
gtgcgcaagacttgctaccgtatcgtggagcacagctggtttgagagcttcatcatcttc
atgatcctgctcagcagtggatctctggcctttgaagactattacctggaccagaagccc
acggtgaaagctttgctggagtacactgacagggtcttcacctttatctttgtgttcgag
atgctgcttaagtgggtggcctatggcttcaaaaagtacttcaccaatgcctggtgctgg
ctggacttcctcattgtgaatatctcactgataagtctcacagcgaagattctggaatat
tctgaagtggctcccatcaaagcccttcgaacccttcgcgctctgcggccactgcgggct
ctttctcgatttgaaggcatgcgggtggtggtggatgccctggtgggcgccatcccatcc
atcatgaatgtcctcctcgtctgcctcatcttctggctcatcttcagcatcatgggtgtg
aacctcttcgcagggaagttttggaggtgcatcaactataccgatggagagttttccctt
gtacctttgtcgattgtgaataacaagtctgactgcaagattcaaaactccactggcagc
ttcttctgggtcaatgtgaaagtcaactttgataatgttgcaatgggttaccttgcactt
ctgcaggtggcaacctttaaaggctggatggacattatgtatgcagctgttgattcccgg
gaggtcaacatgcaacccaagtgggaggacaacgtgtacatgtatttgtactttgtcatc
ttcatcatttttggaggcttcttcacactgaatctctttgttggggtcataattgacaac
ttcaatcaacagaaaaaaaagttagggggccaggacatcttcatgacagaggagcagaag
aaatactacaatgccatgaagaagttgggctccaagaagccccagaagcccatcccacgg
cccctgaacaagttccagggttttgtctttgacatcgtgaccagacaagcttttgacatc
accatcatggtcctcatctgcctcaacatgatcaccatgatggtggagactgatgaccaa
agtgaagaaaagacgaaaattctgggcaaaatcaaccagttctttgtggccgtcttcaca
ggcgaatgtgtcatgaagatgttcgctttgaggcagtactacttcacaaatggctggaat
gtgtttgacttcattgtggtggttctctccattgcgagcctgattttttctgcaattctt
aagtcacttcaaagttacttctccccaacgctcttcagagtcatccgcctggcccgaatt
ggccgcatcctcagactgatccgagcggccaaggggatccgcacactgctctttgccctc
atgatgtccctgcctgccctcttcaacatcgggctgttgctattccttgtcatgttcatc
tactctatcttcggtatgtccagctttccccatgtgaggtgggaggctggcatcgacgac
atgttcaacttccagaccttcgccaacagcatgctgtgcctcttccagattaccacgtcg
gccggctgggatggcctcctcagccccatcctcaacacagggcccccctactgtgacccc
aatctgcccaacagcaatggcaccagaggggactgtgggagcccagccgtaggcatcatc
ttcttcaccacctacatcatcatctccttcctcatcgtggtcaacatgtacattgcagtg
attctggagaacttcaatgtggccacggaggagagcactgagcccctgagtgaggacgac
tttgacatgttctatgagacctgggagaagtttgacccagaggccactcagtttattacc
ttttctgctctctcggactttgcagacactctctctggtcccctgagaatcccaaaaccc
aatcgaaatatactgatccagatggacctgcctttggtccctggagataagatccactgc
ttggacatcctttttgctttcaccaagaatgtcctaggagaatccggggagttggattct
ctgaaggcaaatatggaggagaagtttatggcaactaatctttcaaaatcatcctatgaa
ccaatagcaaccactctccgatggaagcaagaagacatttcagccactgtcattcaaaag
gcctatcggagctatgtgctgcaccgctccatggcactctctaacaccccatgtgtgccc
agagctgaggaggaggctgcatcactcccagatgaaggttttgttgcattcacagcaaat
gaaaattgtgtactcccagacaaatctgaaactgcttctgccacatcattcccaccgtcc
tatgagagtgtcactagaggccttagtgatagagtcaacatgaggacatctagctcaata
caaaatgaagatgaagccaccagtatggagctgattgcccctgggccctag

DBGET integrated database retrieval system