KEGG   Homo sapiens (human): 64072Help
Entry
64072             CDS       T01001                                 

Gene name
CDH23, CDHR23, USH1D, DFNB12
Definition
cadherin-related 23
Orthology
K06813  
cadherin 23
Organism
hsa  Homo sapiens (human)
Disease
H00605  
Deafness, autosomal recessive
H00779  
Usher syndrome (US)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q22.1
AA seq 1381 aa AA seqDB search
MGRHVATSCHVAWLLVLISGCWGQVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLAQDM
DNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNI
QVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSQFFAI
DSARGIVTVIRELDYETTQAYQLTVNATDQDKTRPLSTLANLAIIITDVQDMDPIFINLP
YSTNIYEHSPPGTTVRIITAIDQDKGRPRGIGYTIVSGNTNSIFALDYISGVLTLNGLLD
RENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITEL
AQVGFALPLFIQVVDKDENLGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLD
YETVDRYDFDLFANESVPDHVGYAKVKITLINENDNRPIFSQPLYNISLYENVTVGTSVL
TVLATDNDAGTFGEVSYFFSDDPDRFSLDKDTGLIMLIARLDYELIQRFTLTIIARDGGG
EETTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDEDSPPNNQITYSI
VSASAFGSYFDISLYEGYGVISVSRPLDYEQISNGLIYLTVMAMDAGNPPLNSTVPVTIE
VFDENDNPPTFSKPAYFVSVVENIMAGATVLFLNATDLDRSREYGQESIIYSLEGSTQFR
INARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNITLLDINDNHPTWKD
APYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIQPPNKFYSLNSTTGKIRTTHAML
DRENPDPHEAELMRKIVVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFQNLPFVAEVL
EGIPAGVSIYQVVAIDLDEGLNGLVSYRMPVGMPRMDFLINSSSGVVVTTTELDRERIAE
YQLRVVASDAGTPTKSSTSTLTIHVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWLNCT
DNDVGLNAELSYFITGGNVDGKFSVGYRDAVVRTVVGLDRETTAAYMLILEAIDNGPVGK
RHTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSILQLKATDADEGEFGRVWYR
ILHGNHGNNFRIHVSNGLLMRGPRPLDRERNSSHVLIVEAYNHDLGPMRSSVRVIVYVED
INDEAPVFTQQQYSRLGLRETAGIGTSVIVVQATDRDSGDGGLVNYRILSGAEGKFEIDE
STGLIITVNYLDYETKTSYMMNVSATDQAPPFNQGFCSVYITLLNELDEAVQFSNASYEA
AILENLALGTEIVRVQAYSIDNLNQITYRFNAYTSTQAKALFKIDAITVRGWGQGAPFLP
I
NT seq 4146 nt NT seq  +upstreamnt  +downstreamnt
atggggcgccatgttgccaccagctgccacgtggcctggcttttggtgctgatctctgga
tgctggggccaggtgaaccggctgcccttcttcaccaaccacttctttgatacatacctg
ctgatcagcgaggacacgcctgtgggttcttctgtgacccagttgctggcccaagacatg
gacaatgaccccctggtgtttggcgtgtctggggaggaggcctctcgcttctttgcagtg
gagcctgacactggcgtggtgtggctccggcagccactggacagagagaccaagtcagag
ttcaccgtggagttctctgtcagcgaccaccagggggtgatcacacggaaggtgaacatc
caggttggggatgtgaatgacaacgcgcccacatttcacaatcagccctacagcgtccgc
atccctgagaatacaccagtggggacgcccatcttcatcgtgaatgccacagaccccgac
ttgggggcagggggcagcgtcctctactccttccagcccccctcccaattcttcgccatt
gacagcgcccgcggtatcgtcacagtgatccgggagctggactacgagaccacacaggcc
taccagctcacggtcaacgccacagatcaagacaagaccaggcctctgtccaccctggcc
aacttggccatcatcatcacagatgtccaggacatggaccccatcttcatcaacctgcct
tacagcaccaacatctacgagcattctcctccgggcacgacggtgcgcatcatcaccgcc
atagaccaggataaaggacgtccccggggcattggctacaccatcgtttcagggaatacc
aacagcatctttgccctggactacatcagcggagtgctgaccttgaatggcctgctggac
cgggagaaccccctgtacagccatggcttcatcctgactgtgaagggcacggagctgaac
gatgaccgcaccccatctgacgctacagtcaccacgaccttcaatatcctggttattgac
atcaatgacaatgccccggagttcaacagctccgagtacagcgtggccatcactgagctg
gcacaggtcggctttgcccttccactcttcatccaggtggtggacaaggatgagaatttg
ggcctgaacagcatgtttgaggtgtacttggtggggaacaactcccaccacttcatcatc
tccccgacctccgtccaggggaaggcggacattcgtattcgggtggccatcccactggac
tacgagaccgtggaccgctacgactttgatctctttgccaatgagagtgtgcctgaccat
gtgggctatgccaaggtgaagatcactctcatcaatgaaaatgacaaccggcccatcttc
agccagccactgtacaacatcagcctgtacgagaacgtcaccgtggggacctctgtgctg
acagtcctggcaactgacaatgatgcaggcacctttggggaagtcagctacttcttcagt
gatgaccctgacaggttctcgctggacaaggacacgggactcatcatgctgattgccagg
ctggactatgagctcatccagcgcttcaccctgacgatcattgcccgggacgggggcggc
gaggagaccacaggccgggtcaggatcaatgtgttggatgtcaacgacaacgtgcccacc
ttccagaaggatgcctacgtgggtgctctgcgggagaacgagccttctgtcacacagctg
gtgcggctccgggcaacagatgaagactcccctcccaacaaccagatcacctacagcatt
gtcagtgcatctgcctttggcagctacttcgacatcagcctgtacgagggctatggagtg
atcagcgtcagtcgccccctggattatgaacagatatccaatgggctgatttatctgacg
gtcatggccatggatgctggcaacccccctctcaacagcaccgtccctgtcaccatcgag
gtgtttgatgagaatgacaaccctcccaccttcagcaagcccgcctacttcgtctccgtg
gtggagaacatcatggcaggagccacggtgctgttcctgaatgccacagacctggaccgc
tcccgggagtacggccaggagtccatcatctactccttggaaggctccacccagtttcgg
atcaatgcccgctcaggggaaatcaccaccacgtctctgcttgaccgagagaccaagtct
gaatacatcctcatcgttcgcgcagtggacgggggtgtgggccacaaccagaaaactggc
atcgccaccgtaaacatcaccctcctggacatcaatgacaaccaccccacgtggaaggac
gcaccctactacatcaacctggtggagatgacccctccagactctgatgtgaccacggtg
gtggctgttgacccagacctgggggagaatggcaccctggtgtacagcatccagccaccc
aacaagttctacagcctcaacagcaccacgggcaagatccgcaccacccacgccatgctg
gaccgggagaaccccgacccccatgaggccgagctgatgcgcaaaatcgtcgtctctgtt
actgactgtggcaggccccctctgaaagccaccagcagtgccacagtgtttgtgaacctc
ttggatctcaatgacaatgaccccacctttcagaacctgccttttgtggccgaggtgctt
gaaggcatcccggcgggggtctccatctaccaagtggtggccatcgacctcgatgagggc
ctgaacggcctggtgtcctaccgcatgccggtgggcatgccccgcatggacttcctcatc
aacagcagcagcggcgtggtggtcaccaccaccgagctggaccgcgagcgcatcgcggag
taccagctgcgggtggtggccagtgatgcaggcacgcccaccaagagctccaccagcacg
ctcaccatccatgtgctggatgtgaacgacgagacgcccaccttcttcccggccgtgtac
aatgtgtctgtgtccgaggacgtgccacgcgagttccgggtggtctggctgaactgcacg
gacaacgacgtgggcctcaatgcagagctcagctacttcatcacaggtggcaacgtggat
gggaagttcagcgtgggttaccgcgatgccgttgtgagaaccgtggtgggcctggaccgg
gagaccacagccgcctacatgctcatcctggaggccatcgacaacggccctgtagggaag
cgacacacgggcacagccaccgtgttcgtcactgtcctggatgtgaatgacaaccggccc
atctttctgcagagcagctatgaggccagcgtccctgaggacatccctgaaggccacagc
atcttgcagctgaaagccacggacgcagatgagggcgagtttgggcgtgtgtggtaccgc
atcctccatggtaaccatggcaacaacttccggatccatgtcagcaatgggctcctgatg
cgagggccccggcccctggaccgggagcggaactcatcccacgtgctgatagtggaggcc
tacaaccacgacctgggccccatgcggagctccgtcagggtgattgtgtacgtggaggac
atcaacgatgaggcccccgtgttcacacagcagcagtacagccgtctggggcttcgagag
accgcaggcattggaacgtcagtcatcgtggtccaagccacagaccgagactctggggat
ggtggcctggtgaactaccgcatcctgtcgggcgcagaggggaagtttgagattgacgag
agcacagggcttatcatcaccgtgaattacctggactacgagaccaagaccagctacatg
atgaatgtgtcggccactgaccaggccccgcccttcaaccagggcttctgcagcgtctac
atcactctgctcaacgagctggacgaggccgtgcagttctccaatgcctcatacgaggct
gccatcctggagaatctggcactgggtactgagattgtgcgggtccaggcctactccatc
gacaacctcaaccaaatcacgtaccgcttcaacgcctacaccagcacccaggccaaagcc
ctcttcaagatagacgccatcacggtgaggggctgggggcagggagcaccatttcttcca
atctaa

DBGET integrated database retrieval system