KEGG   Homo sapiens (human): 64072Help
Entry
64072             CDS       T01001                                 

Gene name
CDH23, CDHR23, USH1D, DFNB12
Definition
(RefSeq) cadherin-related 23
  KO
K06813  
cadherin 23
Organism
hsa  Homo sapiens (human)
Disease
H00605  
Deafness, autosomal recessive
H00779  
Usher syndrome (US)
Brite
Cell adhesion molecules and their ligands [BR:hsa04516]
 5. Cadherin Family
  Classic Cadherins
   Other classic cadherins
    CDH23; cadherin 23 [KO:K06813]
     64072 (CDH23)
  Non-clustered protocadherin
   PCDH15; protocadherin-15 [KO:K16500]
    64072 (CDH23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q22.1
AA seq 3354 aa AA seqDB search
MGRHVATSCHVAWLLVLISGCWGQVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLAQDM
DNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNI
QVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSQFFAI
DSARGIVTVIRELDYETTQAYQLTVNATDQDKTRPLSTLANLAIIITDVQDMDPIFINLP
YSTNIYEHSPPGTTVRIITAIDQDKGRPRGIGYTIVSGNTNSIFALDYISGVLTLNGLLD
RENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITEL
AQVGFALPLFIQVVDKDENLGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLD
YETVDRYDFDLFANESVPDHVGYAKVKITLINENDNRPIFSQPLYNISLYENVTVGTSVL
TVLATDNDAGTFGEVSYFFSDDPDRFSLDKDTGLIMLIARLDYELIQRFTLTIIARDGGG
EETTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDEDSPPNNQITYSI
VSASAFGSYFDISLYEGYGVISVSRPLDYEQISNGLIYLTVMAMDAGNPPLNSTVPVTIE
VFDENDNPPTFSKPAYFVSVVENIMAGATVLFLNATDLDRSREYGQESIIYSLEGSTQFR
INARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNITLLDINDNHPTWKD
APYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIQPPNKFYSLNSTTGKIRTTHAML
DRENPDPHEAELMRKIVVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFQNLPFVAEVL
EGIPAGVSIYQVVAIDLDEGLNGLVSYRMPVGMPRMDFLINSSSGVVVTTTELDRERIAE
YQLRVVASDAGTPTKSSTSTLTIHVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWLNCT
DNDVGLNAELSYFITGGNVDGKFSVGYRDAVVRTVVGLDRETTAAYMLILEAIDNGPVGK
RHTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSILQLKATDADEGEFGRVWYR
ILHGNHGNNFRIHVSNGLLMRGPRPLDRERNSSHVLIVEAYNHDLGPMRSSVRVIVYVED
INDEAPVFTQQQYSRLGLRETAGIGTSVIVVQATDRDSGDGGLVNYRILSGAEGKFEIDE
STGLIITVNYLDYETKTSYMMNVSATDQAPPFNQGFCSVYITLLNELDEAVQFSNASYEA
AILENLALGTEIVRVQAYSIDNLNQITYRFNAYTSTQAKALFKIDAITGVITVQGLVDRE
KGDFYTLTVVADDGGPKVDSTVKVYITVLDENDNSPRFDFTSDSAVSIPEDCPVGQRVAT
VKAWDPDAGSNGQVVFSLASGNIAGAFEIVTTNDSIGEVFVARPLDREELDHYILQVVAS
DRGTPPRKKDHILQVTILDINDNPPVIESPFGYNVSVNENVGGGTAVVQVRATDRDIGIN
SVLSYYITEGNKDMAFRMDRISGEIATRPAPPDRERQSFYHLVATVEDEGTPTLSATTHV
YVTIVDENDNAPMFQQPHYEVLLDEGPDTLNTSLITIQALDLDEGPNGTVTYAIVAGNIV
NTFRIDRHMGVITAAKELDYEISHGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDN
VPTFPRDYEGPFEVTEGQPGPRVWTFLAHDRDSGPNGQVEYSIMDGDPLGEFVISPVEGV
LRVRKDVELDRETIAFYNLTICARDRGMPPLSSTMLVGIRVLDINDNDPVLLNLPMNITI
SENSPVSSFVAHVLASDADSGCNARLTFNITAGNRERAFFINATTGIVTVNRPLDRERIP
EYKLTISVKDNPENPRIARRDYDLLLIFLSDENDNHPLFTKSTYQAEVMENSPAGTPLTV
LNGPILALDADQDIYAVVTYQLLGAQSGLFDINSSTGVVTVRSGVIIDREAFSPPILELL
LLAEDIGLLNSTAHLLITILDDNDNRPTFSPATLTVHLLENCPPGFSVLQVTATDEDSGL
NGELVYRIEAGAQDRFLIHLVTGVIRVGNATIDREEQESYRLTVVATDRGTVPLSGTAIV
TILIDDINDSRPEFLNPIQTVSVLESAEPGTVIANITAIDHDLNPKLEYHIVGIVAKDDT
DRLVPNQEDAFAVNINTGSVMVKSPMNRELVATYEVTLSVIDNASDLPERSVSVPNAKLT
VNVLDVNDNTPQFKPFGITYYMERILEGATPGTTLIAVAAVDPDKGLNGLVTYTLLDLVP
PGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNP
IFDQPSYQEAVFEDVPVGTIILTVTATDADSGNFALIEYSLGDGESKFAINPTTGDIYVL
SSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIQVLDVNDCRPQFSKPQFSTSVYE
NEPAGTSVITMMATDQDEGPNGELTYSLEGPGVEAFHVDMDSGLVTTQRPLQSYEKFSLT
VVATDGGEPPLWGTTMLLVEVIDVNDNRPVFVRPPNGTILHIREEIPLRSNVYEVYATDK
DEGLNGAVRYSFLKTAGNRDWEFFIIDPISGLIQTAQRLDRESQAVYSLILVASDLGQPV
PYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEGP
NAIVYYFIAAGNEEKNFHLQPDGCLLVLRDLDREREAIFSFIVKASSNRSWTPPRGPSPT
LDLVADLTLQEVRVVLEDINDQPPRFTKAEYTAGVATDAKVGSELIQVLALDADIGNNSL
VFYSILAIHYFRALANDSEDVGQVFTMGSMDGILRTFDLFMAYSPGYFVVDIVARDLAGH
NDTAIIGIYILRDDQRVKIVINEIPDRVRGFEEEFIHLLSNITGAIVNTDNVQFHVDKKG
RVNFAQTELLIHVVNRDTNRILDVDRVIQMIDENKEQLRNLFRNYNVLDVQPAISVRLPD
DMSALQMAIIVLAILLFLAAMLFVLMNWYYRTVHKRKLKAIVAGSAGNRGFIDIMDMPNT
NKYSFDGANPVWLDPFCRNLELAAQAEHEDDLPENLSEIADLWNSPTRTHGTFGREPAAV
KPDDDRYLRAAIQEYDNIAKLGQIIREGPIKGSLLKVVLEDYLRLKKLFAQRMVQKASSC
HSSISELIQTELDEEPGDHSPGQGSLRFRHKPPVELKGPDGIHVVHGSTGTLLATDLNSL
PEEDQKGLGRSLETLTAAEATAFERNARTESAKSTPLHKLRDVIMETPLEITEL
NT seq 10065 nt NT seq  +upstreamnt  +downstreamnt
atggggcgccatgttgccaccagctgccacgtggcctggcttttggtgctgatctctgga
tgctggggccaggtgaaccggctgcccttcttcaccaaccacttctttgatacatacctg
ctgatcagcgaggacacgcctgtgggttcttctgtgacccagttgctggcccaagacatg
gacaatgaccccctggtgtttggcgtgtctggggaggaggcctctcgcttctttgcagtg
gagcctgacactggcgtggtgtggctccggcagccactggacagagagaccaagtcagag
ttcaccgtggagttctctgtcagcgaccaccagggggtgatcacacggaaggtgaacatc
caggttggggatgtgaatgacaacgcgcccacatttcacaatcagccctacagcgtccgc
atccctgagaatacaccagtggggacgcccatcttcatcgtgaatgccacagaccccgac
ttgggggcagggggcagcgtcctctactccttccagcccccctcccaattcttcgccatt
gacagcgcccgcggtatcgtcacagtgatccgggagctggactacgagaccacacaggcc
taccagctcacggtcaacgccacagatcaagacaagaccaggcctctgtccaccctggcc
aacttggccatcatcatcacagatgtccaggacatggaccccatcttcatcaacctgcct
tacagcaccaacatctacgagcattctcctccgggcacgacggtgcgcatcatcaccgcc
atagaccaggataaaggacgtccccggggcattggctacaccatcgtttcagggaatacc
aacagcatctttgccctggactacatcagcggagtgctgaccttgaatggcctgctggac
cgggagaaccccctgtacagccatggcttcatcctgactgtgaagggcacggagctgaac
gatgaccgcaccccatctgacgctacagtcaccacgaccttcaatatcctggttattgac
atcaatgacaatgccccggagttcaacagctccgagtacagcgtggccatcactgagctg
gcacaggtcggctttgcccttccactcttcatccaggtggtggacaaggatgagaatttg
ggcctgaacagcatgtttgaggtgtacttggtggggaacaactcccaccacttcatcatc
tccccgacctccgtccaggggaaggcggacattcgtattcgggtggccatcccactggac
tacgagaccgtggaccgctacgactttgatctctttgccaatgagagtgtgcctgaccat
gtgggctatgccaaggtgaagatcactctcatcaatgaaaatgacaaccggcccatcttc
agccagccactgtacaacatcagcctgtacgagaacgtcaccgtggggacctctgtgctg
acagtcctggcaactgacaatgatgcaggcacctttggggaagtcagctacttcttcagt
gatgaccctgacaggttctcgctggacaaggacacgggactcatcatgctgattgccagg
ctggactatgagctcatccagcgcttcaccctgacgatcattgcccgggacgggggcggc
gaggagaccacaggccgggtcaggatcaatgtgttggatgtcaacgacaacgtgcccacc
ttccagaaggatgcctacgtgggtgctctgcgggagaacgagccttctgtcacacagctg
gtgcggctccgggcaacagatgaagactcccctcccaacaaccagatcacctacagcatt
gtcagtgcatctgcctttggcagctacttcgacatcagcctgtacgagggctatggagtg
atcagcgtcagtcgccccctggattatgaacagatatccaatgggctgatttatctgacg
gtcatggccatggatgctggcaacccccctctcaacagcaccgtccctgtcaccatcgag
gtgtttgatgagaatgacaaccctcccaccttcagcaagcccgcctacttcgtctccgtg
gtggagaacatcatggcaggagccacggtgctgttcctgaatgccacagacctggaccgc
tcccgggagtacggccaggagtccatcatctactccttggaaggctccacccagtttcgg
atcaatgcccgctcaggggaaatcaccaccacgtctctgcttgaccgagagaccaagtct
gaatacatcctcatcgttcgcgcagtggacgggggtgtgggccacaaccagaaaactggc
atcgccaccgtaaacatcaccctcctggacatcaatgacaaccaccccacgtggaaggac
gcaccctactacatcaacctggtggagatgacccctccagactctgatgtgaccacggtg
gtggctgttgacccagacctgggggagaatggcaccctggtgtacagcatccagccaccc
aacaagttctacagcctcaacagcaccacgggcaagatccgcaccacccacgccatgctg
gaccgggagaaccccgacccccatgaggccgagctgatgcgcaaaatcgtcgtctctgtt
actgactgtggcaggccccctctgaaagccaccagcagtgccacagtgtttgtgaacctc
ttggatctcaatgacaatgaccccacctttcagaacctgccttttgtggccgaggtgctt
gaaggcatcccggcgggggtctccatctaccaagtggtggccatcgacctcgatgagggc
ctgaacggcctggtgtcctaccgcatgccggtgggcatgccccgcatggacttcctcatc
aacagcagcagcggcgtggtggtcaccaccaccgagctggaccgcgagcgcatcgcggag
taccagctgcgggtggtggccagtgatgcaggcacgcccaccaagagctccaccagcacg
ctcaccatccatgtgctggatgtgaacgacgagacgcccaccttcttcccggccgtgtac
aatgtgtctgtgtccgaggacgtgccacgcgagttccgggtggtctggctgaactgcacg
gacaacgacgtgggcctcaatgcagagctcagctacttcatcacaggtggcaacgtggat
gggaagttcagcgtgggttaccgcgatgccgttgtgagaaccgtggtgggcctggaccgg
gagaccacagccgcctacatgctcatcctggaggccatcgacaacggccctgtagggaag
cgacacacgggcacagccaccgtgttcgtcactgtcctggatgtgaatgacaaccggccc
atctttctgcagagcagctatgaggccagcgtccctgaggacatccctgaaggccacagc
atcttgcagctgaaagccacggacgcagatgagggcgagtttgggcgtgtgtggtaccgc
atcctccatggtaaccatggcaacaacttccggatccatgtcagcaatgggctcctgatg
cgagggccccggcccctggaccgggagcggaactcatcccacgtgctgatagtggaggcc
tacaaccacgacctgggccccatgcggagctccgtcagggtgattgtgtacgtggaggac
atcaacgatgaggcccccgtgttcacacagcagcagtacagccgtctggggcttcgagag
accgcaggcattggaacgtcagtcatcgtggtccaagccacagaccgagactctggggat
ggtggcctggtgaactaccgcatcctgtcgggcgcagaggggaagtttgagattgacgag
agcacagggcttatcatcaccgtgaattacctggactacgagaccaagaccagctacatg
atgaatgtgtcggccactgaccaggccccgcccttcaaccagggcttctgcagcgtctac
atcactctgctcaacgagctggacgaggccgtgcagttctccaatgcctcatacgaggct
gccatcctggagaatctggcactgggtactgagattgtgcgggtccaggcctactccatc
gacaacctcaaccaaatcacgtaccgcttcaacgcctacaccagcacccaggccaaagcc
ctcttcaagatagacgccatcacgggtgtgatcacagtccagggcctggtggaccgtgag
aagggcgacttctataccttgacagtggtggcagatgacggcggccccaaggtggactcc
accgtgaaggtctacatcactgtgctggacgagaatgacaacagcccccggtttgacttc
acctccgactcggcggtcagcatacccgaggactgccctgtgggccagcgagtggctact
gtcaaggcctgggaccctgatgctggcagcaatgggcaggtggtcttctccctggcctct
ggcaacatcgcgggggcctttgagatcgtcaccaccaatgactccattggcgaagtgttt
gtggccaggcccctggacagagaagagctggatcactacatcctccaggttgtggcttct
gaccgaggcacccctccacggaagaaggaccacatcctgcaggtgaccatcctggacatc
aatgacaaccctccagtcatcgagagcccctttggatacaatgtcagtgtgaatgagaac
gtgggtggaggtactgctgtggtccaggtgagagccactgaccgtgacatcgggatcaac
agtgttctgtcctactacatcaccgagggcaacaaggacatggccttccgcatggaccgc
atcagcggtgagatcgccacacggcctgccccgcctgaccgcgagcgccagagcttctac
cacctggtggccactgtggaggacgagggcaccccaaccctgtcggccaccacgcacgtg
tacgtgaccattgtggatgagaatgataacgcgcccatgttccagcagccccactatgag
gtgctgctggatgagggcccagacacgctcaacaccagcctcatcaccatccaggcactg
gacctggatgagggtcccaacggcacagtcacctatgccatcgtcgcaggcaacatcgtc
aacaccttccgcatcgacagacacatgggtgtcatcactgctgccaaagagctggactac
gagatcagccacggccgctacaccctgatcgtcactgccacagaccagtgccccatctta
tcccaccgcctcacctctaccaccacggtgcttgtgaatgtgaatgacatcaacgacaat
gtgcctaccttcccccgggactatgagggaccatttgaagtcactgagggccagccgggg
cccagagtgtggaccttcctggcccatgaccgagactcaggacccaacgggcaggtggag
tacagcatcatggatggagaccctctgggggagtttgtgatctctcctgtggagggggtg
ctaagggtccggaaggacgtggagctggaccgggagaccatcgccttctacaacctgacc
atctgtgcccgtgaccgggggatgcccccactcagctccacaatgctggtggggatccgg
gtgctggacatcaacgacaacgaccctgtgctgctgaacctgcccatgaacatcaccatc
agcgagaacagccctgtctccagctttgtcgcccatgtcctggccagtgacgctgacagt
ggctgcaatgcacgcctcaccttcaacatcactgcgggcaaccgcgagcgggccttcttc
atcaatgccacgacagggatcgtcactgtgaaccggcccctggaccgcgagcggatccca
gagtacaagctgaccatttctgtgaaggacaacccggagaatccacgcatagccaggagg
gattatgacttgcttctgatcttcctttctgatgagaatgacaaccaccccctcttcact
aaaagcacctaccaggcagaggtgatggaaaactctcccgctggcacccctctcacggtg
ctcaatgggcccatcctggccctggatgcagaccaagacatctacgccgtggtgacctac
cagctgctgggtgcccagagtggcctctttgacatcaacagcagcaccggtgtggtgacc
gtgaggtcaggtgtcatcattgaccgggaggcattctcgccacccatcctggagctgctg
ctgctggctgaggacatcgggctgctcaacagcacggcccacctgctcatcaccatcctg
gatgacaatgacaaccggcccacctttagccctgccaccctcactgtccatctgctagag
aactgcccgcctggattctcagtccttcaagtcacagccacagatgaggacagtggcctc
aatggggagctggtctaccgaatagaagctggggctcaggaccgcttcctcattcatctg
gtcaccggggtcatccgtgttggtaatgccaccatcgacagagaggagcaggagtcctac
aggctaacggtggtggccaccgaccggggcaccgttcctctctcgggcacagccattgtc
accattctgatcgatgacatcaatgactcccgccccgagttcctcaaccccatccagaca
gtgagcgtgctggagtcggctgagccaggcactgtcattgccaatatcacggccattgac
cacgacctcaacccaaagctagagtaccacattgtcggcattgtggccaaggacgacact
gatcgcctggtgcccaaccaggaggacgcctttgctgtgaatatcaacacaggatctgta
atggtgaagtcccccatgaatcgggagctggttgccacctatgaggtcactctctcagtg
attgacaatgccagcgacctaccagagcgctctgtcagtgtgccaaatgccaagctgact
gtcaacgtcctggacgtcaatgacaatacgccccagttcaagccctttgggatcacctac
tacatggagcggatcctggagggggccacccctgggaccacactcattgctgtggcagcc
gtggaccctgacaagggccttaatgggctggtcacctacaccctgctggacctggtgccc
ccagggtatgtccagctggaggactcctcggcagggaaggtcattgccaaccggacagtg
gactacgaggaggtgcactggctcaactttaccgtgagggcctcagacaacgggtccccg
ccccgggcagctgagatccctgtctacctggaaatcgtggacatcaatgacaacaacccc
atctttgaccagccctcctaccaggaggctgtctttgaggatgtgcctgtgggcacaatc
atcctgacagtcactgccactgatgctgactcaggcaactttgcactcattgagtacagc
cttggagatggagagagcaagtttgccatcaaccccaccacgggtgacatctatgtgctg
tcttctctggaccgggagaagaaggaccactatatcctgactgccttggccaaagacaac
cctggggatgtagccagcaaccgtcgcgaaaattcagtgcaggtggtgatccaagtgctg
gatgtcaatgactgccggccacagttctccaagccccagttcagcacaagcgtgtatgag
aatgagccggcgggcacctcggtcatcaccatgatggccactgaccaggatgaaggtccc
aatggagagttgacctactcacttgagggccctggcgtggaggccttccatgtggacatg
gactcgggcttggtgaccacacagcggccactgcagtcctacgagaagttcagtctgacc
gtggtggccacagatggtggagagcccccactctggggcaccaccatgctcctggtggag
gtcatcgacgtcaatgacaaccgccctgtctttgtgcgcccacccaacggcaccatcctc
cacatcagagaggagatcccgctgcgctccaacgtgtacgaggtctacgccacggacaag
gatgagggcctcaacggggcggtgcgctacagcttcctgaagactgcgggcaaccgggac
tgggagttcttcatcatcgacccaatcagcggcctcatccagactgctcagcgcctggac
cgcgagtcgcaggcggtgtacagcctcatcttggtggccagcgacctgggccagccagtg
ccatacgagactatgcagccgctgcaggtggccctggaggacatcgatgacaacgaaccc
cttttcgtgaggcctccaaaaggcagcccccagtaccagctgctgacagtgcctgagcac
tcaccacgcggcaccctcgtgggcaacgtgacaggcgcagtggatgcagatgagggcccc
aacgcgatcgtgtactacttcatcgcagccggcaacgaagagaagaacttccatctgcag
cccgatgggtgtctgctggtgctgcgggacctggaccgggagcgagaagccatcttctcc
ttcatcgtcaaggcctccagcaatcgcagctggacacctccccgtggaccctccccaacc
ctcgacctggttgctgacctcacactgcaggaggtgcgcgttgtgctagaggacatcaac
gaccagccaccacgcttcaccaaggctgagtacactgcaggggtggccaccgacgccaag
gtgggctcagagttgatccaggtgctggccctggatgcagacattggcaacaacagcctt
gtcttctacagcattctggccatccactacttccgggcccttgccaacgactctgaagat
gtgggccaggtcttcaccatggggagcatggacggcattctgcgcaccttcgacctcttc
atggcctacagccccggctacttcgtggtggacattgtggcccgagacctggcaggccac
aacgacacggccatcatcggcatctacatcctgagggacgaccagcgcgtcaagatcgtc
attaacgagatccccgaccgtgtgcgcggcttcgaggaggagttcatccacctgctctcc
aacatcactggggccattgtcaatactgacaatgtgcagttccatgtggacaagaagggc
cgggtgaactttgcgcagacagaactgcttatccacgtggtgaaccgcgataccaaccgc
atcctggacgtggaccgggtgatccagatgatcgatgagaacaaggagcagctacggaat
cttttccggaactacaacgtcctggacgtgcagcctgccatctctgtccggctgccggat
gacatgtctgccctgcagatggcgatcatcgtcctggctatcctcctgttcctggccgcc
atgctctttgtcctcatgaactggtactacaggactgtacacaagaggaagctcaaggcc
attgtggctggctcagctgggaatcgtggcttcatcgacatcatggacatgcctaacacc
aacaagtactcctttgatggagccaaccctgtgtggctggatcccttctgtcggaacctg
gagctggccgcccaggcggagcatgaggatgacctaccggagaacctgagtgagatcgcc
gacctgtggaacagccccacgcgcacccatggaacttttgggcgtgagccagcagctgtc
aagcctgatgatgaccgatacctgcgggctgccatccaggagtatgacaacattgccaag
ctgggccagatcattcgtgaggggccaatcaagggctcgctgctgaaggtggtcctggag
gattacctgcggctcaaaaagctctttgcacagcggatggtgcaaaaagcctcctcctgc
cactcctccatctctgagctgatacagactgagctggacgaggagccaggagaccacagc
ccagggcagggtagcctgcgcttccgccacaagccaccagtggagctcaaggggcccgat
gggatccatgtggtgcacggcagcacgggcacgctgctggccaccgacctcaacagcctg
cccgaggaagaccagaagggcctgggccgctcgctggagacgctgaccgctgccgaggcc
actgccttcgagcgcaacgcccgcacagaatccgccaaatccacacccctgcacaaactt
cgcgacgtgatcatggagacccccctggagatcacagagctgtga

DBGET integrated database retrieval system