KEGG   Homo sapiens (human): 64072Help
Entry
64072             CDS       T01001                                 

Gene name
CDH23, CDHR23, USH1D, DFNB12
Definition
(RefSeq) cadherin related 23
  KO
K06813  
cadherin 23
Organism
hsa  Homo sapiens (human)
Disease
H00605  
Deafness, autosomal recessive
H00779  
Usher syndrome (US)
H01705  
Bilateral sudden sensorineural hearing loss
Brite
Cell adhesion molecules and their ligands [BR:hsa04516]
 5. Cadherin Family
  Classic Cadherins
   Other classic cadherins
    CDH23; cadherin 23 [KO:K06813]
     64072 (CDH23)
  Non-clustered protocadherin
   PCDH15; protocadherin-15 [KO:K16500]
    64072 (CDH23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9H251(Tbio)
UniProt: 
Position
10q22.1
AA seq 3354 aa AA seqDB search
MGRHVATSCHVAWLLVLISGCWGQVNRLPFFTNHFFDTYLLISEDTPVGSSVTQLLAQDM
DNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNI
QVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSQFFAI
DSARGIVTVIRELDYETTQAYQLTVNATDQDKTRPLSTLANLAIIITDVQDMDPIFINLP
YSTNIYEHSPPGTTVRIITAIDQDKGRPRGIGYTIVSGNTNSIFALDYISGVLTLNGLLD
RENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITEL
AQVGFALPLFIQVVDKDENLGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLD
YETVDRYDFDLFANESVPDHVGYAKVKITLINENDNRPIFSQPLYNISLYENVTVGTSVL
TVLATDNDAGTFGEVSYFFSDDPDRFSLDKDTGLIMLIARLDYELIQRFTLTIIARDGGG
EETTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDEDSPPNNQITYSI
VSASAFGSYFDISLYEGYGVISVSRPLDYEQISNGLIYLTVMAMDAGNPPLNSTVPVTIE
VFDENDNPPTFSKPAYFVSVVENIMAGATVLFLNATDLDRSREYGQESIIYSLEGSTQFR
INARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNITLLDINDNHPTWKD
APYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIQPPNKFYSLNSTTGKIRTTHAML
DRENPDPHEAELMRKIVVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFQNLPFVAEVL
EGIPAGVSIYQVVAIDLDEGLNGLVSYRMPVGMPRMDFLINSSSGVVVTTTELDRERIAE
YQLRVVASDAGTPTKSSTSTLTIHVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWLNCT
DNDVGLNAELSYFITGGNVDGKFSVGYRDAVVRTVVGLDRETTAAYMLILEAIDNGPVGK
RHTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSILQLKATDADEGEFGRVWYR
ILHGNHGNNFRIHVSNGLLMRGPRPLDRERNSSHVLIVEAYNHDLGPMRSSVRVIVYVED
INDEAPVFTQQQYSRLGLRETAGIGTSVIVVQATDRDSGDGGLVNYRILSGAEGKFEIDE
STGLIITVNYLDYETKTSYMMNVSATDQAPPFNQGFCSVYITLLNELDEAVQFSNASYEA
AILENLALGTEIVRVQAYSIDNLNQITYRFNAYTSTQAKALFKIDAITGVITVQGLVDRE
KGDFYTLTVVADDGGPKVDSTVKVYITVLDENDNSPRFDFTSDSAVSIPEDCPVGQRVAT
VKAWDPDAGSNGQVVFSLASGNIAGAFEIVTTNDSIGEVFVARPLDREELDHYILQVVAS
DRGTPPRKKDHILQVTILDINDNPPVIESPFGYNVSVNENVGGGTAVVQVRATDRDIGIN
SVLSYYITEGNKDMAFRMDRISGEIATRPAPPDRERQSFYHLVATVEDEGTPTLSATTHV
YVTIVDENDNAPMFQQPHYEVLLDEGPDTLNTSLITIQALDLDEGPNGTVTYAIVAGNIV
NTFRIDRHMGVITAAKELDYEISHGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDN
VPTFPRDYEGPFEVTEGQPGPRVWTFLAHDRDSGPNGQVEYSIMDGDPLGEFVISPVEGV
LRVRKDVELDRETIAFYNLTICARDRGMPPLSSTMLVGIRVLDINDNDPVLLNLPMNITI
SENSPVSSFVAHVLASDADSGCNARLTFNITAGNRERAFFINATTGIVTVNRPLDRERIP
EYKLTISVKDNPENPRIARRDYDLLLIFLSDENDNHPLFTKSTYQAEVMENSPAGTPLTV
LNGPILALDADQDIYAVVTYQLLGAQSGLFDINSSTGVVTVRSGVIIDREAFSPPILELL
LLAEDIGLLNSTAHLLITILDDNDNRPTFSPATLTVHLLENCPPGFSVLQVTATDEDSGL
NGELVYRIEAGAQDRFLIHLVTGVIRVGNATIDREEQESYRLTVVATDRGTVPLSGTAIV
TILIDDINDSRPEFLNPIQTVSVLESAEPGTVIANITAIDHDLNPKLEYHIVGIVAKDDT
DRLVPNQEDAFAVNINTGSVMVKSPMNRELVATYEVTLSVIDNASDLPERSVSVPNAKLT
VNVLDVNDNTPQFKPFGITYYMERILEGATPGTTLIAVAAVDPDKGLNGLVTYTLLDLVP
PGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNP
IFDQPSYQEAVFEDVPVGTIILTVTATDADSGNFALIEYSLGDGESKFAINPTTGDIYVL
SSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIQVLDVNDCRPQFSKPQFSTSVYE
NEPAGTSVITMMATDQDEGPNGELTYSLEGPGVEAFHVDMDSGLVTTQRPLQSYEKFSLT
VVATDGGEPPLWGTTMLLVEVIDVNDNRPVFVRPPNGTILHIREEIPLRSNVYEVYATDK
DEGLNGAVRYSFLKTAGNRDWEFFIIDPISGLIQTAQRLDRESQAVYSLILVASDLGQPV
PYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEGP
NAIVYYFIAAGNEEKNFHLQPDGCLLVLRDLDREREAIFSFIVKASSNRSWTPPRGPSPT
LDLVADLTLQEVRVVLEDINDQPPRFTKAEYTAGVATDAKVGSELIQVLALDADIGNNSL
VFYSILAIHYFRALANDSEDVGQVFTMGSMDGILRTFDLFMAYSPGYFVVDIVARDLAGH
NDTAIIGIYILRDDQRVKIVINEIPDRVRGFEEEFIHLLSNITGAIVNTDNVQFHVDKKG
RVNFAQTELLIHVVNRDTNRILDVDRVIQMIDENKEQLRNLFRNYNVLDVQPAISVRLPD
DMSALQMAIIVLAILLFLAAMLFVLMNWYYRTVHKRKLKAIVAGSAGNRGFIDIMDMPNT
NKYSFDGANPVWLDPFCRNLELAAQAEHEDDLPENLSEIADLWNSPTRTHGTFGREPAAV
KPDDDRYLRAAIQEYDNIAKLGQIIREGPIKGSLLKVVLEDYLRLKKLFAQRMVQKASSC
HSSISELIQTELDEEPGDHSPGQGSLRFRHKPPVELKGPDGIHVVHGSTGTLLATDLNSL
PEEDQKGLGRSLETLTAAEATAFERNARTESAKSTPLHKLRDVIMETPLEITEL
NT seq 10065 nt NT seq  +upstreamnt  +downstreamnt
atggggcgccatgttgccaccagctgccacgtggcctggcttttggtgctgatctctgga
tgctggggccaggtgaaccggctgcccttcttcaccaaccacttctttgatacatacctg
ctgatcagcgaggacacgcctgtgggttcttctgtgacccagttgctggcccaagacatg
gacaatgaccccctggtgtttggcgtgtctggggaggaggcctctcgcttctttgcagtg
gagcctgacactggcgtggtgtggctccggcagccactggacagagagaccaagtcagag
ttcaccgtggagttctctgtcagcgaccaccagggggtgatcacacggaaggtgaacatc
caggttggggatgtgaatgacaacgcgcccacatttcacaatcagccctacagcgtccgc
atccctgagaatacaccagtggggacgcccatcttcatcgtgaatgccacagaccccgac
ttgggggcagggggcagcgtcctctactccttccagcccccctcccaattcttcgccatt
gacagcgcccgcggtatcgtcacagtgatccgggagctggactacgagaccacacaggcc
taccagctcacggtcaacgccacagatcaagacaagaccaggcctctgtccaccctggcc
aacttggccatcatcatcacagatgtccaggacatggaccccatcttcatcaacctgcct
tacagcaccaacatctacgagcattctcctccgggcacgacggtgcgcatcatcaccgcc
atagaccaggataaaggacgtccccggggcattggctacaccatcgtttcagggaatacc
aacagcatctttgccctggactacatcagcggagtgctgaccttgaatggcctgctggac
cgggagaaccccctgtacagccatggcttcatcctgactgtgaagggcacggagctgaac
gatgaccgcaccccatctgacgctacagtcaccacgaccttcaatatcctggttattgac
atcaatgacaatgccccggagttcaacagctccgagtacagcgtggccatcactgagctg
gcacaggtcggctttgcccttccactcttcatccaggtggtggacaaggatgagaatttg
ggcctgaacagcatgtttgaggtgtacttggtggggaacaactcccaccacttcatcatc
tccccgacctccgtccaggggaaggcggacattcgtattcgggtggccatcccactggac
tacgagaccgtggaccgctacgactttgatctctttgccaatgagagtgtgcctgaccat
gtgggctatgccaaggtgaagatcactctcatcaatgaaaatgacaaccggcccatcttc
agccagccactgtacaacatcagcctgtacgagaacgtcaccgtggggacctctgtgctg
acagtcctggcaactgacaatgatgcaggcacctttggggaagtcagctacttcttcagt
gatgaccctgacaggttctcgctggacaaggacacgggactcatcatgctgattgccagg
ctggactatgagctcatccagcgcttcaccctgacgatcattgcccgggacgggggcggc
gaggagaccacaggccgggtcaggatcaatgtgttggatgtcaacgacaacgtgcccacc
ttccagaaggatgcctacgtgggtgctctgcgggagaacgagccttctgtcacacagctg
gtgcggctccgggcaacagatgaagactcccctcccaacaaccagatcacctacagcatt
gtcagtgcatctgcctttggcagctacttcgacatcagcctgtacgagggctatggagtg
atcagcgtcagtcgccccctggattatgaacagatatccaatgggctgatttatctgacg
gtcatggccatggatgctggcaacccccctctcaacagcaccgtccctgtcaccatcgag
gtgtttgatgagaatgacaaccctcccaccttcagcaagcccgcctacttcgtctccgtg
gtggagaacatcatggcaggagccacggtgctgttcctgaatgccacagacctggaccgc
tcccgggagtacggccaggagtccatcatctactccttggaaggctccacccagtttcgg
atcaatgcccgctcaggggaaatcaccaccacgtctctgcttgaccgagagaccaagtct
gaatacatcctcatcgttcgcgcagtggacgggggtgtgggccacaaccagaaaactggc
atcgccaccgtaaacatcaccctcctggacatcaatgacaaccaccccacgtggaaggac
gcaccctactacatcaacctggtggagatgacccctccagactctgatgtgaccacggtg
gtggctgttgacccagacctgggggagaatggcaccctggtgtacagcatccagccaccc
aacaagttctacagcctcaacagcaccacgggcaagatccgcaccacccacgccatgctg
gaccgggagaaccccgacccccatgaggccgagctgatgcgcaaaatcgtcgtctctgtt
actgactgtggcaggccccctctgaaagccaccagcagtgccacagtgtttgtgaacctc
ttggatctcaatgacaatgaccccacctttcagaacctgccttttgtggccgaggtgctt
gaaggcatcccggcgggggtctccatctaccaagtggtggccatcgacctcgatgagggc
ctgaacggcctggtgtcctaccgcatgccggtgggcatgccccgcatggacttcctcatc
aacagcagcagcggcgtggtggtcaccaccaccgagctggaccgcgagcgcatcgcggag
taccagctgcgggtggtggccagtgatgcaggcacgcccaccaagagctccaccagcacg
ctcaccatccatgtgctggatgtgaacgacgagacgcccaccttcttcccggccgtgtac
aatgtgtctgtgtccgaggacgtgccacgcgagttccgggtggtctggctgaactgcacg
gacaacgacgtgggcctcaatgcagagctcagctacttcatcacaggtggcaacgtggat
gggaagttcagcgtgggttaccgcgatgccgttgtgagaaccgtggtgggcctggaccgg
gagaccacagccgcctacatgctcatcctggaggccatcgacaacggccctgtagggaag
cgacacacgggcacagccaccgtgttcgtcactgtcctggatgtgaatgacaaccggccc
atctttctgcagagcagctatgaggccagcgtccctgaggacatccctgaaggccacagc
atcttgcagctgaaagccacggacgcagatgagggcgagtttgggcgtgtgtggtaccgc
atcctccatggtaaccatggcaacaacttccggatccatgtcagcaatgggctcctgatg
cgagggccccggcccctggaccgggagcggaactcatcccacgtgctgatagtggaggcc
tacaaccacgacctgggccccatgcggagctccgtcagggtgattgtgtacgtggaggac
atcaacgatgaggcccccgtgttcacacagcagcagtacagccgtctggggcttcgagag
accgcaggcattggaacgtcagtcatcgtggtccaagccacagaccgagactctggggat
ggtggcctggtgaactaccgcatcctgtcgggcgcagaggggaagtttgagattgacgag
agcacagggcttatcatcaccgtgaattacctggactacgagaccaagaccagctacatg
atgaatgtgtcggccactgaccaggccccgcccttcaaccagggcttctgcagcgtctac
atcactctgctcaacgagctggacgaggccgtgcagttctccaatgcctcatacgaggct
gccatcctggagaatctggcactgggtactgagattgtgcgggtccaggcctactccatc
gacaacctcaaccaaatcacgtaccgcttcaacgcctacaccagcacccaggccaaagcc
ctcttcaagatagacgccatcacgggtgtgatcacagtccagggcctggtggaccgtgag
aagggcgacttctataccttgacagtggtggcagatgacggcggccccaaggtggactcc
accgtgaaggtctacatcactgtgctggacgagaatgacaacagcccccggtttgacttc
acctccgactcggcggtcagcatacccgaggactgccctgtgggccagcgagtggctact
gtcaaggcctgggaccctgatgctggcagcaatgggcaggtggtcttctccctggcctct
ggcaacatcgcgggggcctttgagatcgtcaccaccaatgactccattggcgaagtgttt
gtggccaggcccctggacagagaagagctggatcactacatcctccaggttgtggcttct
gaccgaggcacccctccacggaagaaggaccacatcctgcaggtgaccatcctggacatc
aatgacaaccctccagtcatcgagagcccctttggatacaatgtcagtgtgaatgagaac
gtgggtggaggtactgctgtggtccaggtgagagccactgaccgtgacatcgggatcaac
agtgttctgtcctactacatcaccgagggcaacaaggacatggccttccgcatggaccgc
atcagcggtgagatcgccacacggcctgccccgcctgaccgcgagcgccagagcttctac
cacctggtggccactgtggaggacgagggcaccccaaccctgtcggccaccacgcacgtg
tacgtgaccattgtggatgagaatgataacgcgcccatgttccagcagccccactatgag
gtgctgctggatgagggcccagacacgctcaacaccagcctcatcaccatccaggcactg
gacctggatgagggtcccaacggcacagtcacctatgccatcgtcgcaggcaacatcgtc
aacaccttccgcatcgacagacacatgggtgtcatcactgctgccaaagagctggactac
gagatcagccacggccgctacaccctgatcgtcactgccacagaccagtgccccatctta
tcccaccgcctcacctctaccaccacggtgcttgtgaatgtgaatgacatcaacgacaat
gtgcctaccttcccccgggactatgagggaccatttgaagtcactgagggccagccgggg
cccagagtgtggaccttcctggcccatgaccgagactcaggacccaacgggcaggtggag
tacagcatcatggatggagaccctctgggggagtttgtgatctctcctgtggagggggtg
ctaagggtccggaaggacgtggagctggaccgggagaccatcgccttctacaacctgacc
atctgtgcccgtgaccgggggatgcccccactcagctccacaatgctggtggggatccgg
gtgctggacatcaacgacaacgaccctgtgctgctgaacctgcccatgaacatcaccatc
agcgagaacagccctgtctccagctttgtcgcccatgtcctggccagtgacgctgacagt
ggctgcaatgcacgcctcaccttcaacatcactgcgggcaaccgcgagcgggccttcttc
atcaatgccacgacagggatcgtcactgtgaaccggcccctggaccgcgagcggatccca
gagtacaagctgaccatttctgtgaaggacaacccggagaatccacgcatagccaggagg
gattatgacttgcttctgatcttcctttctgatgagaatgacaaccaccccctcttcact
aaaagcacctaccaggcagaggtgatggaaaactctcccgctggcacccctctcacggtg
ctcaatgggcccatcctggccctggatgcagaccaagacatctacgccgtggtgacctac
cagctgctgggtgcccagagtggcctctttgacatcaacagcagcaccggtgtggtgacc
gtgaggtcaggtgtcatcattgaccgggaggcattctcgccacccatcctggagctgctg
ctgctggctgaggacatcgggctgctcaacagcacggcccacctgctcatcaccatcctg
gatgacaatgacaaccggcccacctttagccctgccaccctcactgtccatctgctagag
aactgcccgcctggattctcagtccttcaagtcacagccacagatgaggacagtggcctc
aatggggagctggtctaccgaatagaagctggggctcaggaccgcttcctcattcatctg
gtcaccggggtcatccgtgttggtaatgccaccatcgacagagaggagcaggagtcctac
aggctaacggtggtggccaccgaccggggcaccgttcctctctcgggcacagccattgtc
accattctgatcgatgacatcaatgactcccgccccgagttcctcaaccccatccagaca
gtgagcgtgctggagtcggctgagccaggcactgtcattgccaatatcacggccattgac
cacgacctcaacccaaagctagagtaccacattgtcggcattgtggccaaggacgacact
gatcgcctggtgcccaaccaggaggacgcctttgctgtgaatatcaacacaggatctgta
atggtgaagtcccccatgaatcgggagctggttgccacctatgaggtcactctctcagtg
attgacaatgccagcgacctaccagagcgctctgtcagtgtgccaaatgccaagctgact
gtcaacgtcctggacgtcaatgacaatacgccccagttcaagccctttgggatcacctac
tacatggagcggatcctggagggggccacccctgggaccacactcattgctgtggcagcc
gtggaccctgacaagggccttaatgggctggtcacctacaccctgctggacctggtgccc
ccagggtatgtccagctggaggactcctcggcagggaaggtcattgccaaccggacagtg
gactacgaggaggtgcactggctcaactttaccgtgagggcctcagacaacgggtccccg
ccccgggcagctgagatccctgtctacctggaaatcgtggacatcaatgacaacaacccc
atctttgaccagccctcctaccaggaggctgtctttgaggatgtgcctgtgggcacaatc
atcctgacagtcactgccactgatgctgactcaggcaactttgcactcattgagtacagc
cttggagatggagagagcaagtttgccatcaaccccaccacgggtgacatctatgtgctg
tcttctctggaccgggagaagaaggaccactatatcctgactgccttggccaaagacaac
cctggggatgtagccagcaaccgtcgcgaaaattcagtgcaggtggtgatccaagtgctg
gatgtcaatgactgccggccacagttctccaagccccagttcagcacaagcgtgtatgag
aatgagccggcgggcacctcggtcatcaccatgatggccactgaccaggatgaaggtccc
aatggagagttgacctactcacttgagggccctggcgtggaggccttccatgtggacatg
gactcgggcttggtgaccacacagcggccactgcagtcctacgagaagttcagtctgacc
gtggtggccacagatggtggagagcccccactctggggcaccaccatgctcctggtggag
gtcatcgacgtcaatgacaaccgccctgtctttgtgcgcccacccaacggcaccatcctc
cacatcagagaggagatcccgctgcgctccaacgtgtacgaggtctacgccacggacaag
gatgagggcctcaacggggcggtgcgctacagcttcctgaagactgcgggcaaccgggac
tgggagttcttcatcatcgacccaatcagcggcctcatccagactgctcagcgcctggac
cgcgagtcgcaggcggtgtacagcctcatcttggtggccagcgacctgggccagccagtg
ccatacgagactatgcagccgctgcaggtggccctggaggacatcgatgacaacgaaccc
cttttcgtgaggcctccaaaaggcagcccccagtaccagctgctgacagtgcctgagcac
tcaccacgcggcaccctcgtgggcaacgtgacaggcgcagtggatgcagatgagggcccc
aacgcgatcgtgtactacttcatcgcagccggcaacgaagagaagaacttccatctgcag
cccgatgggtgtctgctggtgctgcgggacctggaccgggagcgagaagccatcttctcc
ttcatcgtcaaggcctccagcaatcgcagctggacacctccccgtggaccctccccaacc
ctcgacctggttgctgacctcacactgcaggaggtgcgcgttgtgctagaggacatcaac
gaccagccaccacgcttcaccaaggctgagtacactgcaggggtggccaccgacgccaag
gtgggctcagagttgatccaggtgctggccctggatgcagacattggcaacaacagcctt
gtcttctacagcattctggccatccactacttccgggcccttgccaacgactctgaagat
gtgggccaggtcttcaccatggggagcatggacggcattctgcgcaccttcgacctcttc
atggcctacagccccggctacttcgtggtggacattgtggcccgagacctggcaggccac
aacgacacggccatcatcggcatctacatcctgagggacgaccagcgcgtcaagatcgtc
attaacgagatccccgaccgtgtgcgcggcttcgaggaggagttcatccacctgctctcc
aacatcactggggccattgtcaatactgacaatgtgcagttccatgtggacaagaagggc
cgggtgaactttgcgcagacagaactgcttatccacgtggtgaaccgcgataccaaccgc
atcctggacgtggaccgggtgatccagatgatcgatgagaacaaggagcagctacggaat
cttttccggaactacaacgtcctggacgtgcagcctgccatctctgtccggctgccggat
gacatgtctgccctgcagatggcgatcatcgtcctggctatcctcctgttcctggccgcc
atgctctttgtcctcatgaactggtactacaggactgtacacaagaggaagctcaaggcc
attgtggctggctcagctgggaatcgtggcttcatcgacatcatggacatgcctaacacc
aacaagtactcctttgatggagccaaccctgtgtggctggatcccttctgtcggaacctg
gagctggccgcccaggcggagcatgaggatgacctaccggagaacctgagtgagatcgcc
gacctgtggaacagccccacgcgcacccatggaacttttgggcgtgagccagcagctgtc
aagcctgatgatgaccgatacctgcgggctgccatccaggagtatgacaacattgccaag
ctgggccagatcattcgtgaggggccaatcaagggctcgctgctgaaggtggtcctggag
gattacctgcggctcaaaaagctctttgcacagcggatggtgcaaaaagcctcctcctgc
cactcctccatctctgagctgatacagactgagctggacgaggagccaggagaccacagc
ccagggcagggtagcctgcgcttccgccacaagccaccagtggagctcaaggggcccgat
gggatccatgtggtgcacggcagcacgggcacgctgctggccaccgacctcaacagcctg
cccgaggaagaccagaagggcctgggccgctcgctggagacgctgaccgctgccgaggcc
actgccttcgagcgcaacgcccgcacagaatccgccaaatccacacccctgcacaaactt
cgcgacgtgatcatggagacccccctggagatcacagagctgtga

DBGET integrated database retrieval system