KEGG   Homo sapiens (human): 64221Help
Entry
64221             CDS       T01001                                 

Gene name
ROBO3, HGPPS, HGPS, RBIG1, RIG1
Definition
roundabout, axon guidance receptor, homolog 3 (Drosophila)
Orthology
K06755  
roundabout, axon guidance receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Class
Organismal Systems; Development; Axon guidance [PATH:hsa04360]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q24.2
AA seq 1386 aa AA seqDB search
MLRYLLKTLLQMNLFADSLAGDISNSSELLLGFNSSLAALNHTLLPPGDPSLNGSRVGPE
DAMPRIVEQPPDLLVSRGEPATLPCRAEGRPRPNIEWYKNGARVATVREDPRAHRLLLPS
GALFFPRIVHGRRARPDEGVYTCVARNYLGAAASRNASLEVAVLRDDFRQSPGNVVVAVG
EPAVLECVPPRGHPEPSVSWRKDGARLKEEEGRITIRGGKLMMSHTLKSDAGMYVCVASN
MAGERESAAAEVMVLERPSFLRRPVNQVVLADAPVTFLCEVKGDPPPRLRWRKEDGELPT
GRYEIRSDHSLWIGHVSAEDEGTYTCVAENSVGRAEASGSLSVHVPPQLVTQPQDQMAAP
GESVAFQCETKGNPPPAIFWQKEGSQVLLFPSQSLQPTGRFSVSPRGQLNITAVQRGDAG
YYVCQAVSVAGSILAKALLEIKGASLDGLPPVILQGPANQTLVLGSSVWLPCRVTGNPQP
SVRWKKDGQWLQGDDLQFKTMANGTLYIANVQEMDMGFYSCVAKSSTGEATWSGWLKMRE
DWGVSPDPPTEPSSPPGAPSQPVVTEITKNSITLTWKPNPQTGAAVTSYVIEAFSPAAGN
TWRTVADGVQLETHTVSGLQPNTIYLFLVRAVGAWGLSEPSPVSEPVRTQDSSPSRPVED
PWRGQQGLAEVAVRLQEPIVLGPRTLQVSWTVDGPVQLVQGFRVSWRVAGPEGGSWTMLD
LQSPSQQSTVLRGLPPGTQIQIKVQAQGQEGLGAESLSVTRSIPEEAPSGPPQGVAVALG
GDGNSSITVSWEPPLPSQQNGVITEYQIWCLGNESRFHLNRSAAGWARSAMLRGLVPGLL
YRTLVAAATSAGVGVPSAPVLVQLPSPPDLEPGLEVGAGLAVRLARVLREPAFLAGSGAA
CGALLLGLCAALYWRRKQRKELSHYTASFAYTPAVSFPHSEGLSGASSRPPMGLGPAPYS
WLADSWPHPSRSPSAQEPRGSCCPSNPDPDDRYYNEAGISLYLAQTARGTAAPGEGPVYS
TIDPAGEELQTFHGGFPQHPSGDLGPWSQYAPPEWSQGDSGAKGGKVKLLGKPVQMPSLN
WPEALPPPPPSCELSCLEGPEEELEGSSEPEEWCPPMPERSHLTEPSSSGGCLVTPSRRE
TPSPTPSYGQQSTATLTPSPPDPPQPPTDMPHLHQMPRRVPLGPSSPLSVSQPMLGIREA
RPAGLGAGPAASPHLSPSPAPSTASSAPGRTWQGNGEMTPPLQGPRARFRKKPKALPYRR
ENSPGDLPPPPLPPPEEEASWALELRAAGSMSSLERERSGERKAVQAVPLAAQRVLHPDE
EAWLPYSRPSFLSRGQGTSTCSTAGSNSSRGSSSSRGSRGPGRSRSRSQSRSQSQRPGQK
RREEPR
NT seq 4161 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgctacctgctgaaaacgctgctgcagatgaacttgttcgcggactctctggcc
ggggacatctccaactccagcgagctgctcttgggcttcaactcctcgctggcggcgctc
aaccacaccctgctgcctcccggcgatccctctctcaacgggtcaagggtaggaccggag
gacgctatgccccgcatcgtggagcagccgccagatctgctggtctcccgaggcgagccc
gccacgttgccctgccgcgctgaaggccgaccccgacccaacattgagtggtacaagaac
ggggcgcgtgtggccactgtgcgggaggatccgcgtgcgcaccgcctgctgctgcccagc
ggcgccctcttcttcccgcgcatcgtgcacgggcgccgcgcgcggccggacgaaggtgtc
tacacttgcgtggctcgcaactacctgggggcagcagcgagcagaaacgcctcgctggaa
gtggcagtcctccgtgatgatttccggcagtctcctggaaacgtggtggtggcagtgggg
gagccagcagtactggaatgcgtgcccccccgcggccacccggagccttccgtgtcctgg
aggaaggacggtgcaagactcaaggaagaggaaggaaggatcacgatccgtggagggaag
ctgatgatgtcacatacactcaagagcgatgcaggcatgtatgtgtgcgtagcctccaac
atggcgggagaacgggagagtgcggcagctgaagtcatggtactggagcgtccctcattc
ctgcgcagaccagtgaatcaggtggtcctggctgatgcccctgtgactttcctatgtgag
gtgaagggggatcccccacctcgtctacgctggcgcaaggaggatggggaactgcccaca
ggcaggtatgagatccggagtgaccacagcctttggattgggcatgtgagtgccgaagat
gagggaacgtacacctgtgtggcggagaacagtgtgggccgcgctgaagcatctggctcc
ctcagtgttcacgtcccaccccagttggtgacccagccccaggaccagatggcagctcct
ggagagagcgtggctttccagtgcgagaccaaaggaaaccccccacctgccatcttctgg
cagaaggaggggagtcaggtcctgcttttccccagtcagtcacttcagccgacggggcgc
ttctcagtgtctccaagaggccaacttaacatcaccgcggtgcagcgtggggatgctggg
tactacgtgtgccaggctgtcagtgtggctggcagcatcctggccaaggccctgctggag
ataaaaggagcctctttggatgggctgcctcctgtcatcctccagggaccagccaatcag
acgctggtgcttggctcctccgtgtggctgccctgcagagtgactgggaaccctcaaccc
agtgtccgatggaagaaggatgggcagtggctgcagggggatgacctccagttcaagaca
atggccaacggtaccctgtacatcgccaatgtgcaggagatggacatgggcttctacagc
tgcgtggccaagagttccacaggggaagccacatggagcggctggcttaagatgcgggaa
gactggggagtatcaccagacccccctacagaacccagttcccctccgggggctccctct
cagccagtggtcactgagatcaccaagaacagcattaccctgacctggaagcccaaccca
caaactggggctgcagtcacgtcttatgtgatagaggccttcagcccagcagctggcaac
acatggcgtactgtggcagatggcgtgcagctggagacacacacagtcagcggtctgcag
cccaataccatctacctgtttctggttcgagcagtgggagcctggggcctcagtgagccc
agccccgtctctgagcctgtccgtacacaggatagcagcccctctaggccagtggaggac
ccatggagaggccagcagggactggcggaagtggctgtgcgcctgcaggagcccatagtc
ctgggaccccggaccctgcaggtgtcctggactgtggatggcccagtccagctggtgcaa
ggtttccgggtgtcttggagggtagcaggccctgagggaggaagctggacaatgttggac
ctacagtccccaagccagcaaagtactgtgctaagaggactccctccagggacccaaatc
cagatcaaggtgcaagcccaaggccaggaggggctgggggctgaaagcctctctgtgacc
aggagcattcctgaggaggcccccagtggccccccacagggagtggcggtggccttgggg
ggtgatggcaacagcagtatcactgtgtcctgggaacctccactcccctcccagcaaaat
ggggtcatcacggaataccagatctggtgcctgggcaatgagagccgctttcacctcaat
cgatctgcagcaggctgggcacgctccgcaatgctccgaggactggtgcccggtctcctc
tatcgaaccctggtcgcggcggccaccagcgcaggcgtgggcgtgcccagtgccccagtg
ctggtgcagctgccgtccccgccggacctggagcccgggctggaggtgggcgcggggctg
gcggtgcggctggcgagggtgctgcgggagcccgccttcctcgcgggcagcggcgcagcc
tgcggggcgctgcttctcgggctctgcgccgccctctactggcgccggaaacagcgcaaa
gagctcagccactacacggcctcttttgcctacacaccggcagtgtccttcccgcactca
gagggcctctctggagccagttccaggccacccatgggccttggccccgccccctactca
tggctggcagattcgtggccccacccatctcgaagcccctcggcccaggaacccagggga
agctgctgccctagcaatcctgacccggacgacagatattacaacgaagcgggaatctcc
ctgtatctagctcagacggccaggggcacggccgcccctggcgagggtcctgtctatagc
accattgacccagcgggggaggagctgcagaccttccatgggggcttcccccaacatccc
tcaggagatctgggtccctggagccagtacgctcctccagagtggagccagggggacagt
ggagccaagggaggcaaagtgaagcttctggggaaacctgtgcagatgccctctctgaac
tggccagaagccctgcccccacctcctccttcttgtgaactgagctgcctagaagggccg
gaggaggagctggagggcagctcagagccagaggagtggtgcccgccaatgcctgagaga
agtcacctgacggagcccagctccagtggagggtgcctggtcaccccatcccgaagggaa
accccctctcccacaccttcctatggacagcagtccacagccactcttacaccctcacct
cctgaccctccccagcccccaactgacatgccccatctccatcagatgcccaggagggtg
ccccttgggccgagttcccctctcagtgtatcccagcccatgctgggcatccgtgaagcg
aggcctgctggcttgggtgctggccctgcagcctcaccccacctcagccccagtcctgcc
cctagcacagccagcagtgccccaggcagaacctggcaggggaatggggagatgactccc
ccacttcaaggaccccgtgctcgattccggaagaaacccaaggctcttccctacaggagg
gagaacagtcctggggacttgcccccaccacccttgccaccgccagaggaagaggcgagc
tgggccctagagctgagggcagcaggcagcatgtcctccctggagcgggagcgcagtggg
gagaggaaagcggtccaggccgtgcccctggcagcccagcgggtgctccacccagatgaa
gaggcctggctcccatacagcagaccaagcttcctgtcccggggccagggcaccagcaca
tgttccacggccggcagcaactcttccaggggctccagcagctctaggggctcccggggc
cctggccggagccggagtcggagtcagagccggagccagagccaaaggccaggacagaaa
cgccgagaggaaccaagatga

DBGET integrated database retrieval system