KEGG   Homo sapiens (human): 64221Help
Entry
64221             CDS       T01001                                 

Gene name
ROBO3, HGPPS, HGPPS1, HGPS, RBIG1, RIG1
Definition
(RefSeq) roundabout guidance receptor 3
  KO
K06755  roundabout, axon guidance receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    64221 (ROBO3)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  ROBO family
   64221 (ROBO3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 ig Ig_2 fn3 V-set C2-set_2 Ig_5 Pur_ac_phosph_N
Motif
Other DBs
NCBI-GeneID: 64221
NCBI-ProteinID: NP_071765
OMIM: 608630
HGNC: 13433
Ensembl: ENSG00000154134
Vega: OTTHUMG00000165934
Pharos: Q96MS0(Tbio)
UniProt: Q96MS0
Position
11q24.2
AA seq 1386 aa AA seqDB search
MLRYLLKTLLQMNLFADSLAGDISNSSELLLGFNSSLAALNHTLLPPGDPSLNGSRVGPE
DAMPRIVEQPPDLLVSRGEPATLPCRAEGRPRPNIEWYKNGARVATVREDPRAHRLLLPS
GALFFPRIVHGRRARPDEGVYTCVARNYLGAAASRNASLEVAVLRDDFRQSPGNVVVAVG
EPAVLECVPPRGHPEPSVSWRKDGARLKEEEGRITIRGGKLMMSHTLKSDAGMYVCVASN
MAGERESAAAEVMVLERPSFLRRPVNQVVLADAPVTFLCEVKGDPPPRLRWRKEDGELPT
GRYEIRSDHSLWIGHVSAEDEGTYTCVAENSVGRAEASGSLSVHVPPQLVTQPQDQMAAP
GESVAFQCETKGNPPPAIFWQKEGSQVLLFPSQSLQPTGRFSVSPRGQLNITAVQRGDAG
YYVCQAVSVAGSILAKALLEIKGASLDGLPPVILQGPANQTLVLGSSVWLPCRVTGNPQP
SVRWKKDGQWLQGDDLQFKTMANGTLYIANVQEMDMGFYSCVAKSSTGEATWSGWLKMRE
DWGVSPDPPTEPSSPPGAPSQPVVTEITKNSITLTWKPNPQTGAAVTSYVIEAFSPAAGN
TWRTVADGVQLETHTVSGLQPNTIYLFLVRAVGAWGLSEPSPVSEPVRTQDSSPSRPVED
PWRGQQGLAEVAVRLQEPIVLGPRTLQVSWTVDGPVQLVQGFRVSWRVAGPEGGSWTMLD
LQSPSQQSTVLRGLPPGTQIQIKVQAQGQEGLGAESLSVTRSIPEEAPSGPPQGVAVALG
GDGNSSITVSWEPPLPSQQNGVITEYQIWCLGNESRFHLNRSAAGWARSAMLRGLVPGLL
YRTLVAAATSAGVGVPSAPVLVQLPSPPDLEPGLEVGAGLAVRLARVLREPAFLAGSGAA
CGALLLGLCAALYWRRKQRKELSHYTASFAYTPAVSFPHSEGLSGASSRPPMGLGPAPYS
WLADSWPHPSRSPSAQEPRGSCCPSNPDPDDRYYNEAGISLYLAQTARGTAAPGEGPVYS
TIDPAGEELQTFHGGFPQHPSGDLGPWSQYAPPEWSQGDSGAKGGKVKLLGKPVQMPSLN
WPEALPPPPPSCELSCLEGPEEELEGSSEPEEWCPPMPERSHLTEPSSSGGCLVTPSRRE
TPSPTPSYGQQSTATLTPSPPDPPQPPTDMPHLHQMPRRVPLGPSSPLSVSQPMLGIREA
RPAGLGAGPAASPHLSPSPAPSTASSAPGRTWQGNGEMTPPLQGPRARFRKKPKALPYRR
ENSPGDLPPPPLPPPEEEASWALELRAAGSMSSLERERSGERKAVQAVPLAAQRVLHPDE
EAWLPYSRPSFLSRGQGTSTCSTAGSNSSRGSSSSRGSRGPGRSRSRSQSRSQSQRPGQK
RREEPR
NT seq 4161 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgctacctgctgaaaacgctgctgcagatgaacttgttcgcggactctctggcc
ggggacatctccaactccagcgagctgctcttgggcttcaactcctcgctggcggcgctc
aaccacaccctgctgcctcccggcgatccctctctcaacgggtcaagggtaggaccggag
gacgctatgccccgcatcgtggagcagccgccagatctgctggtctcccgaggcgagccc
gccacgttgccctgccgcgctgaaggccgaccccgacccaacattgagtggtacaagaac
ggggcgcgtgtggccactgtgcgggaggatccgcgtgcgcaccgcctgctgctgcccagc
ggcgccctcttcttcccgcgcatcgtgcacgggcgccgcgcgcggccggacgaaggtgtc
tacacttgcgtggctcgcaactacctgggggcagcagcgagcagaaacgcctcgctggaa
gtggcagtcctccgtgatgatttccggcagtctcctggaaacgtggtggtggcagtgggg
gagccagcagtactggaatgcgtgcccccccgcggccacccggagccttccgtgtcctgg
aggaaggacggtgcaagactcaaggaagaggaaggaaggatcacgatccgtggagggaag
ctgatgatgtcacatacactcaagagcgatgcaggcatgtatgtgtgcgtagcctccaac
atggcgggagaacgggagagtgcggcagctgaagtcatggtactggagcgtccctcattc
ctgcgcagaccagtgaatcaggtggtcctggctgatgcccctgtgactttcctatgtgag
gtgaagggggatcccccacctcgtctacgctggcgcaaggaggatggggaactgcccaca
ggcaggtatgagatccggagtgaccacagcctttggattgggcatgtgagtgccgaagat
gagggaacgtacacctgtgtggcggagaacagtgtgggccgcgctgaagcatctggctcc
ctcagtgttcacgtcccaccccagttggtgacccagccccaggaccagatggcagctcct
ggagagagcgtggctttccagtgcgagaccaaaggaaaccccccacctgccatcttctgg
cagaaggaggggagtcaggtcctgcttttccccagtcagtcacttcagccgacggggcgc
ttctcagtgtctccaagaggccaacttaacatcaccgcggtgcagcgtggggatgctggg
tactacgtgtgccaggctgtcagtgtggctggcagcatcctggccaaggccctgctggag
ataaaaggagcctctttggatgggctgcctcctgtcatcctccagggaccagccaatcag
acgctggtgcttggctcctccgtgtggctgccctgcagagtgactgggaaccctcaaccc
agtgtccgatggaagaaggatgggcagtggctgcagggggatgacctccagttcaagaca
atggccaacggtaccctgtacatcgccaatgtgcaggagatggacatgggcttctacagc
tgcgtggccaagagttccacaggggaagccacatggagcggctggcttaagatgcgggaa
gactggggagtatcaccagacccccctacagaacccagttcccctccgggggctccctct
cagccagtggtcactgagatcaccaagaacagcattaccctgacctggaagcccaaccca
caaactggggctgcagtcacgtcttatgtgatagaggccttcagcccagcagctggcaac
acatggcgtactgtggcagatggcgtgcagctggagacacacacagtcagcggtctgcag
cccaataccatctacctgtttctggttcgagcagtgggagcctggggcctcagtgagccc
agccccgtctctgagcctgtccgtacacaggatagcagcccctctaggccagtggaggac
ccatggagaggccagcagggactggcggaagtggctgtgcgcctgcaggagcccatagtc
ctgggaccccggaccctgcaggtgtcctggactgtggatggcccagtccagctggtgcaa
ggtttccgggtgtcttggagggtagcaggccctgagggaggaagctggacaatgttggac
ctacagtccccaagccagcaaagtactgtgctaagaggactccctccagggacccaaatc
cagatcaaggtgcaagcccaaggccaggaggggctgggggctgaaagcctctctgtgacc
aggagcattcctgaggaggcccccagtggccccccacagggagtggcggtggccttgggg
ggtgatggcaacagcagtatcactgtgtcctgggaacctccactcccctcccagcaaaat
ggggtcatcacggaataccagatctggtgcctgggcaatgagagccgctttcacctcaat
cgatctgcagcaggctgggcacgctccgcaatgctccgaggactggtgcccggtctcctc
tatcgaaccctggtcgcggcggccaccagcgcaggcgtgggcgtgcccagtgccccagtg
ctggtgcagctgccgtccccgccggacctggagcccgggctggaggtgggcgcggggctg
gcggtgcggctggcgagggtgctgcgggagcccgccttcctcgcgggcagcggcgcagcc
tgcggggcgctgcttctcgggctctgcgccgccctctactggcgccggaaacagcgcaaa
gagctcagccactacacggcctcttttgcctacacaccggcagtgtccttcccgcactca
gagggcctctctggagccagttccaggccacccatgggccttggccccgccccctactca
tggctggcagattcgtggccccacccatctcgaagcccctcggcccaggaacccagggga
agctgctgccctagcaatcctgacccggacgacagatattacaacgaagcgggaatctcc
ctgtatctagctcagacggccaggggcacggccgcccctggcgagggtcctgtctatagc
accattgacccagcgggggaggagctgcagaccttccatgggggcttcccccaacatccc
tcaggagatctgggtccctggagccagtacgctcctccagagtggagccagggggacagt
ggagccaagggaggcaaagtgaagcttctggggaaacctgtgcagatgccctctctgaac
tggccagaagccctgcccccacctcctccttcttgtgaactgagctgcctagaagggccg
gaggaggagctggagggcagctcagagccagaggagtggtgcccgccaatgcctgagaga
agtcacctgacggagcccagctccagtggagggtgcctggtcaccccatcccgaagggaa
accccctctcccacaccttcctatggacagcagtccacagccactcttacaccctcacct
cctgaccctccccagcccccaactgacatgccccatctccatcagatgcccaggagggtg
ccccttgggccgagttcccctctcagtgtatcccagcccatgctgggcatccgtgaagcg
aggcctgctggcttgggtgctggccctgcagcctcaccccacctcagccccagtcctgcc
cctagcacagccagcagtgccccaggcagaacctggcaggggaatggggagatgactccc
ccacttcaaggaccccgtgctcgattccggaagaaacccaaggctcttccctacaggagg
gagaacagtcctggggacttgcccccaccacccttgccaccgccagaggaagaggcgagc
tgggccctagagctgagggcagcaggcagcatgtcctccctggagcgggagcgcagtggg
gagaggaaagcggtccaggccgtgcccctggcagcccagcgggtgctccacccagatgaa
gaggcctggctcccatacagcagaccaagcttcctgtcccggggccagggcaccagcaca
tgttccacggccggcagcaactcttccaggggctccagcagctctaggggctcccggggc
cctggccggagccggagtcggagtcagagccggagccagagccaaaggccaggacagaaa
cgccgagaggaaccaagatga

DBGET integrated database retrieval system