KEGG   Homo sapiens (human): 64342Help
Entry
64342             CDS       T01001                                 

Gene name
HS1BP3, ETM2, HS1-BP3
Definition
HCLS1 binding protein 3
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p24.1
AA seq 392 aa AA seqDB search
MQSPAVLVTSRRLQNAHTGLDLTVPQHQEVRGKMMSGHVEYQILVVTRLAAFKSAKHRPE
DVVQFLVSKKYSEIEEFYQKLSSRYAAASLPPLPRKVLFVGESDIRERRAVFNEILRCVS
KDAELAGSPELLEFLGTRSPGAAGLTSRDSSVLDGTDSQTGNDEEAFDFFEEQDQVAEEG
PPVQSLKGEDAEESLEEEEALDPLGIMRSKKPKKHPKVAVKAKPSPRLTIFDEEVDPDEG
LFGPGRKLSPQDPSEDVSSVDPLKLFDDPDLGGAIPLGDSLLLPAACESGGPTPSLSHRD
ASKELFRVEEDLDQILNLGAEPKPKPQLKPKPPVAAKPVIPRKPAVPPKAGPAEAVAGQQ
KPQEQIQAMDEMDILQYIQDHDTPAQAAPSLF
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcagtccccggcggtgctcgtcacctccaggcgacttcagaatgcccacactggcctc
gacctgactgtgccccagcaccaggaggtacggggcaagatgatgtctggacacgtggag
taccagatcctggtggtgacccgtctggctgcgttcaagtcggccaagcacaggcccgag
gatgtcgtccagttcttggtctccaaaaagtacagcgagattgaggagttttaccagaaa
ctgagcagtcgttatgcagcagccagcctccccccactacccaggaaggtcctgtttgtt
ggggagtctgacatccgggagaggagagccgtgttcaatgagatcctgcgctgtgtctcc
aaggatgccgagttggcaggcagcccagagctgctagagttcttaggtaccagatcccca
ggggctgcagggctcaccagcagagattcctctgtcctggatggcacagacagtcagaca
gggaatgatgaagaggctttcgacttttttgaggagcaagaccaagtggcagaagagggt
ccgcccgtccagagcctgaagggcgaggatgctgaggaatccttggaggaggaggaggcg
ctggaccctctgggcattatgcgctccaagaagcccaagaaacatcccaaagtggccgtg
aaagccaagccctcgccccggctcaccatctttgacgaggaggtggaccctgatgagggg
ctctttggcccgggcaggaagctgtctccacaggacccctcggaggacgtgtcatccgtg
gaccccctgaagctatttgatgatcctgacctcggcggggccatccccctgggtgactcc
ctcctgctgccagccgcctgtgagagtggagggcccacacccagcctcagccacagggac
gcctccaaggaactgttcagagttgaagaggacttggaccagattctgaacctgggagct
gagcccaaacccaagccccagcttaagcccaagccaccagtggcagctaagccggtgata
cccagaaaaccagctgttccccccaaagcgggcccggctgaagctgtggctgggcagcag
aagccgcaggagcagatccaagccatggacgagatggacatcttgcagtacatccaggac
cacgatacaccagcccaggccgcccccagcctcttctga

DBGET integrated database retrieval system