KEGG   Homo sapiens (human): 6439Help
Entry
6439              CDS       T01001                                 

Gene name
SFTPB, PSP-B, SFTB3, SFTP3, SMDP1, SP-B
Definition
(RefSeq) surfactant protein B
Organism
hsa  Homo sapiens (human)
Disease
H01122  Congenital pulmonary alveolar proteinosis
SSDB OrthologParalogGFIT
Motif
Pfam: SapB_2 SapA SapB_1
Motif
Other DBs
NCBI-GeneID: 6439
NCBI-ProteinID: NP_000533
OMIM: 178640
HGNC: 10801
Ensembl: ENSG00000168878
Vega: OTTHUMG00000130181
Pharos: P07988(Tbio)
UniProt: P07988 D6W5L6
Structure
PDB: 

Jmol
Position
2p11.2
AA seq 393 aa AA seqDB search
MHQAGYPGCRGAMAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWCQSLEQALQ
CRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLL
MPQCNQVLDDYFPLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPL
PDPLLDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALA
VAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMDDSAGPRSP
TGEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLT
LVPRGWDAHTTCQALGVCGTMSSPLQCIHSPDL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcaccaagcagggtacccaggctgcagaggtgccatggctgagtcacacctgctgcag
tggctgctgctgctgctgcccacgctctgtggcccaggcactgctgcctggaccacctca
tccttggcctgtgcccagggccctgagttctggtgccaaagcctggagcaagcattgcag
tgcagagccctagggcattgcctacaggaagtctggggacatgtgggagccgatgaccta
tgccaagagtgtgaggacatcgtccacatccttaacaagatggccaaggaggccattttc
caggacacgatgaggaagttcctggagcaggagtgcaacgtcctccccttgaagctgctc
atgccccagtgcaaccaagtgcttgacgactacttccccctggtcatcgactacttccag
aaccagactgactcaaacggcatctgtatgcacctgggcctgtgcaaatcccggcagcca
gagccagagcaggagccagggatgtcagaccccctgcccaaacctctgcgggaccctctg
ccagaccctctgctggacaagctcgtcctccctgtgctgcccggggccctccaggcgagg
cctgggcctcacacacaggatctctccgagcagcaattccccattcctctcccctattgc
tggctctgcagggctctgatcaagcggatccaagccatgattcccaagggtgcgctagct
gtggcagtggcccaggtgtgccgcgtggtacctctggtggcgggcggcatctgccagtgc
ctggctgagcgctactccgtcatcctgctcgacacgctgctgggccgcatgctgccccag
ctggtctgccgcctcgtcctccggtgctccatggatgacagcgctggcccaaggtcgccg
acaggagaatggctgccgcgagactctgagtgccacctctgcatgtccgtgaccacccag
gccgggaacagcagcgagcaggccataccacaggcaatgctccaggcctgtgttggctcc
tggctggacagggaaaagtgcaagcaatttgtggagcagcacacgccccagctgctgacc
ctggtgcccaggggctgggatgcccacaccacctgccaggccctcggggtgtgtgggacc
atgtccagccctctccagtgtatccacagccccgacctttga

DBGET integrated database retrieval system