KEGG   Homo sapiens (human): 6440Help
Entry
6440              CDS       T01001                                 

Gene name
SFTPC, BRICD6, PSP-C, SFTP2, SMDP2, SP-C
Definition
surfactant protein C
Organism
hsa  Homo sapiens (human)
Disease
H00217  
Pulmonary surfactant metabolism dysfunction (SMDP)
H01299  
Idiopathic pulmonary fibrosis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8p21
AA seq 191 aa AA seqDB search
MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGLHM
SQKHTEMVLEMSIGAPEAQQRLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTC
CYIMKIAPESIPSLEALTRKVHNFQAKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVS
TLCGEVPLYYI
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgggcagcaaagaggtcctgatggagagcccgccggactactccgcagctccc
cggggccgatttggcattccctgctgcccagtgcacctgaaacgccttcttatcgtggtg
gtggtggtggtcctcatcgtcgtggtgattgtgggagccctgctcatgggtctccacatg
agccagaaacacacggagatggttctggagatgagcattggggcgccggaagcccagcaa
cgcctggccctgagtgagcacctggttaccactgccaccttctccatcggctccactggc
ctcgtggtgtatgactaccagcagctgctgatcgcctacaagccagcccctggcacctgc
tgctacatcatgaagatagctccagagagcatccccagtcttgaggctctcactagaaaa
gtccacaacttccaggccaagcccgcagtgcctacgtctaagctgggccaggcagagggg
cgagatgcaggctcagcaccctccggaggggacccggccttcctgggcatggccgtgagc
accctgtgtggcgaggtgccgctctactacatctag

DBGET integrated database retrieval system