KEGG   Homo sapiens (human): 64409Help
Entry
64409             CDS       T01001                                 

Gene name
WBSCR17, GALNACT17, GALNT16, GALNT20, GALNTL3
Definition
Williams-Beuren syndrome chromosome region 17 (EC:2.4.1.41)
Orthology
K00710  
polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
hsa  Homo sapiens (human)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Module
O-glycan biosynthesis, mucin type core
Class
Metabolism; Glycan biosynthesis and metabolism; Mucin type O-glycan biosynthesis [PATH:hsa00512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q11.23
AA seq 598 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPIAVRSGDAFHEIRPRAEVANLSAHSASPIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYSKDLPQISIIFIFVNEALSVILRSVHSAVNHTP
THLLKEIILVDDNSDEEELKVPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKVATGQ
VTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDNFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDVSERRALRKSLKCKNFQWYLDHVYPEMRRYNNTVAYGELRNNKAKDVCLD
QGPLENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNSKSRLPQLLD
CDKVKSSLYKRWNFIQNGAIMNKGTGRCLEVENRGLAGIDLILRSCTGQRWTIKNSIK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactgagaagagtcaaagtgctgttggtgttgaacttgatcgcggtagccggc
ttcgtgctcttcctggccaagtgccggcccatcgcggtgcgcagcggagacgccttccac
gagatccggccgcgcgccgaggtggccaacctcagcgcgcacagcgccagccccatccag
gatgcggtcctgaagcgcctgtcgctgctggaggacatcgtgtaccggcagctgaatggc
ttatccaaatcccttgggctcattgaaggttatggtgggcggggtaaagggggccttccg
gctactctttccccggctgaagaagaaaaggctaagggaccccatgagaagtatggctac
aattcatacctcagtgaaaaaatttcactggaccgttccattccggattatcgtcccacc
aagtgtaaggagctcaagtactccaaggacctgccccagatatccatcatattcatcttc
gtgaacgaggccctgtcggtgatcctgcggtccgtgcacagtgccgtcaatcacacgccc
acacacctgctgaaggaaatcattctggtggatgacaacagcgacgaagaggagctgaag
gtccccctagaggagtatgtccacaaacgctaccccgggctggtgaaggtggtaagaaat
cagaagagggaaggcctgatccgcgctcgcattgagggctggaaggtggctaccgggcag
gtcactggcttctttgatgcccacgtggaattcaccgctggctgggctgagccggttcta
tcccgcatccaggaaaaccggaagcgtgtgatcctcccctccattgacaacatcaaacag
gacaactttgaggtgcagcggtacgagaactcggcccacgggtacagctgggagctgtgg
tgcatgtacatcagccccccaaaagactggtgggacgccggagacccttctctccccatc
aggaccccagccatgataggctgctcgttcgtggtcaacaggaagttcttcggtgaaatt
ggtcttctggatcctggcatggatgtatacggaggagaaaatattgaactgggaatcaag
gtatggctctgtgggggcagcatggaggtccttccttgctcacgggtggcccacattgag
cggaagaagaagccatataatagcaacattggcttctacaccaagaggaatgctcttcgc
gttgctgaggtctggatggacgattacaagtctcatgtgtacatagcgtggaacctgccg
ctggagaatccgggaattgacatcggtgatgtctccgaaagaagagcattaaggaaaagt
ttaaagtgtaagaatttccagtggtacctggaccatgtttacccagaaatgagaagatac
aataataccgttgcttacggggagcttcgcaacaacaaggcaaaagacgtctgcttggac
caggggccgctggagaaccacacagcaatattgtatccgtgccatggctggggaccacag
cttgcccgctacaccaaggaaggcttcctgcacttgggtgccctggggaccaccacactc
ctccctgacacccgctgcctggtggacaactccaagagtcggctgccccagctcctggac
tgcgacaaggtcaagagcagcctgtacaagcgctggaacttcatccagaatggagccatc
atgaacaagggcacgggacgctgcctggaggtggagaaccggggcctggctggcatcgac
ctcatcctccgcagctgcacaggtcagaggtggaccattaagaactccatcaagtag

DBGET integrated database retrieval system