KEGG   Homo sapiens (human): 6446Help
Entry
6446              CDS       T01001                                 

Gene name
SGK1, SGK
Definition
(RefSeq) serum/glucocorticoid regulated kinase 1
  KO
K13302  serum/glucocorticoid-regulated kinase 1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    6446 (SGK1)
   04151 PI3K-Akt signaling pathway
    6446 (SGK1)
   04150 mTOR signaling pathway
    6446 (SGK1)
 Organismal Systems
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    6446 (SGK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     6446 (SGK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   6446 (SGK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_C FTA2 Kdo Haspin_kinase PX APH Pacs-1
Motif
Other DBs
NCBI-GeneID: 6446
NCBI-ProteinID: NP_005618
OMIM: 602958
HGNC: 10810
Ensembl: ENSG00000118515
Vega: OTTHUMG00000015613
Pharos: O00141(Tchem)
UniProt: O00141
Structure
PDB: 

Jmol
Position
6q23.2
AA seq 431 aa AA seqDB search
MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKI
SQPQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAE
EVFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYIN
GGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTD
FGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSR
NTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINW
DDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLG
FSYAPPTDSFL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgaaaactgaggctgctaagggcaccctcacttactccaggatgaggggcatg
gtggcaattctcatcgctttcatgaagcagaggaggatgggtctgaacgactttattcag
aagattgccaataactcctatgcatgcaaacaccctgaagttcagtccatcttgaagatc
tcccaacctcaggagcctgagcttatgaatgccaacccttctcctccaccaagtccttct
cagcaaatcaaccttggcccgtcgtccaatcctcatgctaaaccatctgactttcacttc
ttgaaagtgatcggaaagggcagttttggaaaggttcttctagcaagacacaaggcagaa
gaagtgttctatgcagtcaaagttttacagaagaaagcaatcctgaaaaagaaagaggag
aagcatattatgtcggagcggaatgttctgttgaagaatgtgaagcaccctttcctggtg
ggccttcacttctctttccagactgctgacaaattgtactttgtcctagactacattaat
ggtggagagttgttctaccatctccagagggaacgctgcttcctggaaccacgggctcgt
ttctatgctgctgaaatagccagtgccttgggctacctgcattcactgaacatcgtttat
agagacttaaaaccagagaatattttgctagattcacagggacacattgtccttactgac
ttcggactctgcaaggagaacattgaacacaacagcacaacatccaccttctgtggcacg
ccggagtatctcgcacctgaggtgcttcataagcagccttatgacaggactgtggactgg
tggtgcctgggagctgtcttgtatgagatgctgtatggcctgccgcctttttatagccga
aacacagctgaaatgtacgacaacattctgaacaagcctctccagctgaaaccaaatatt
acaaattccgcaagacacctcctggagggcctcctgcagaaggacaggacaaagcggctc
ggggccaaggatgacttcatggagattaagagtcatgtcttcttctccttaattaactgg
gatgatctcattaataagaagattactcccccttttaacccaaatgtgagtgggcccaac
gacctacggcactttgaccccgagtttaccgaagagcctgtccccaactccattggcaag
tcccctgacagcgtcctcgtcacagccagcgtcaaggaagctgccgaggctttcctaggc
ttttcctatgcgcctcccacggactctttcctctga

DBGET integrated database retrieval system