KEGG   Homo sapiens (human): 6452Help
Entry
6452              CDS       T01001                                 

Gene name
SH3BP2, 3BP-2, 3BP2, CRBM, CRPM, RES4-23
Definition
(RefSeq) SH3-domain binding protein 2
  KO
K07984  
SH3-domain binding protein 2
Organism
hsa  Homo sapiens (human)
Pathway
Natural killer cell mediated cytotoxicity
Disease
H00497  
Cherubism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    6452 (SH3BP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4p16.3
AA seq 561 aa AA seqDB search
MAAEEMHWPVPMKAIGAQNLLTMPGGVAKAGYLHKKGGTQLQLLKWPLRFVIIHKRCVYY
FKSSTSASPQGAFSLSGYNRVMRAAEETTSNNVFPFKIIHISKKHRTWFFSASSEEERKS
WMALLRREIGHFHEKKDLPLDTSDSSSDTDSFYGAVERPVDISLSPYPTDNEDYEHDDED
DSYLEPDSPEPGRLEDALMHPPAYPPPPVPTPRKPAFSDMPRAHSFTSKGPGPLLPPPPP
KHGLPDVGLAAEDSKRDPLCPRRAEPCPRVPATPRRMSDPPLSTMPTAPGLRKPPCFRES
ASPSPEPWTPGHGACSTSSAAIMATATSRNCDKLKSFHLSPRGPPTSEPPPVPANKPKFL
KIAEEDPPREAAMPGLFVPPVAPRPPALKLPVPEAMARPAVLPRPEKPQLPHLQRSPPDG
QSFRSFSFEKPRQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEP
QDGLYCIRNSSTKSGKVLVVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHYHT
HVLPSHQSLLLRHPYGYTGPR
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgaagagatgcattggcctgtccctatgaaggccattggtgcccagaacctg
ctaaccatgcctgggggcgtggccaaggctggctacctgcacaagaagggcggtacccag
ctgcagctgctgaaatggcccctgcgctttgtcatcatccacaaacgctgcgtctactac
ttcaagagtagcacctctgcctccccgcagggcgccttctccctgagtggctataaccgg
gtgatgcgggcggctgaggagaccacgtccaacaacgttttccccttcaagatcatccat
atcagcaagaagcaccgcacgtggttcttctcggcctcctccgaggaggagcgcaagagc
tggatggccttgctgcgcagggagattggccacttccacgaaaagaaagacctgcccttg
gacaccagcgactccagctcggacacagacagcttctacggcgcagttgagcggcctgtg
gatatcagcctttccccgtaccccacggacaatgaagactatgagcacgacgatgaggat
gactcctacctggagcctgactccccggagcccggaaggcttgaggatgccctgatgcac
ccaccggcttacccaccacccccagtgcccacgcccaggaagccagccttctctgacatg
ccccgggcccactcctttacctccaagggccccggtcccctactgccacccccgccccct
aagcacggcctcccagatgttggcctggctgctgaggactccaagagggacccactgtgc
ccgaggcgggctgagccttgccccagggtacctgctaccccccgaaggatgagcgatccc
cctctgagcaccatgcccaccgcacccggcctccggaaacccccttgcttccgggagagt
gccagccccagcccggagccctggacccctggccacggggcctgctccacttccagtgct
gccatcatggccactgccacctccagaaactgtgacaaactcaagtccttccacctgtcc
ccccgaggaccacccacatctgagcccccacctgtgccagccaacaagcccaagttcctg
aagatagctgaagaggaccccccaagggaggcagccatgcccggactctttgtgcccccc
gtggctccccggcctcctgcgctgaagctgccagtgcctgaggccatggcgcggcccgca
gtcctgcccaggccagagaagccgcagctcccgcacctccagcgatcaccccccgatggg
cagagtttcaggagcttctcctttgaaaagccccggcaaccctcacaggctgacactggc
ggggacgactcggacgaggactatgagaaggtgccactgcccaactcggtcttcgtcaac
accacggagtcctgcgaagtggaaaggttgttcaaggctacaagcccccggggagagccc
caggatggactctactgcatccggaactcctctaccaagtcggggaaggtcctggttgtg
tgggacgaaacctctaacaaagtgaggaactatcgcatttttgagaaggactctaagttc
tacctggagggcgaggtcctgtttgtgagtgtgggcagcatggtggagcactaccacacc
cacgtgctgcccagccaccagagcctgctgctgcggcacccctacggctacactgggcct
aggtga

DBGET integrated database retrieval system