KEGG   Homo sapiens (human): 6476Help
Entry
6476              CDS       T01001                                 

Gene name
SI
Definition
sucrase-isomaltase (alpha-glucosidase) (EC:3.2.1.10 3.2.1.48)
Orthology
K01203  
sucrase-isomaltase / oligo-1,6-glucosidase [EC:3.2.1.48 3.2.1.10]
Organism
hsa  Homo sapiens (human)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Carbohydrate digestion and absorption
Disease
H00115  
Congenital sucrase-isomaltase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    6476 (SI)
   00500 Starch and sucrose metabolism
    6476 (SI)
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    6476 (SI)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.10  oligo-1,6-glucosidase
     6476 (SI)
    3.2.1.48  sucrose alpha-glucosidase
     6476 (SI)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   6476 (SI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q25.2-q26.2
AA seq 1827 aa AA seqDB search
MARKKFSGLEISLIVLFVIVTIIAIALIVVLATKTPAVDEISDSTSTPATTRVTTNPSDS
GKCPNVLNDPVNVRINCIPEQFPTEGICAQRGCCWRPWNDSLIPWCFFVDNHGYNVQDMT
TTSIGVEAKLNRIPSPTLFGNDINSVLFTTQNQTPNRFRFKITDPNNRRYEVPHQYVKEF
TGPTVSDTLYDVKVAQNPFSIQVIRKSNGKTLFDTSIGPLVYSDQYLQISTRLPSDYIYG
IGEQVHKRFRHDLSWKTWPIFTRDQLPGDNNNNLYGHQTFFMCIEDTSGKSFGVFLMNSN
AMEIFIQPTPIVTYRVTGGILDFYILLGDTPEQVVQQYQQLVGLPAMPAYWNLGFQLSRW
NYKSLDVVKEVVRRNREAGIPFDTQVTDIDYMEDKKDFTYDQVAFNGLPQFVQDLHDHGQ
KYVIILDPAISIGRRANGTTYATYERGNTQHVWINESDGSTPIIGEVWPGLTVYPDFTNP
NCIDWWANECSIFHQEVQYDGLWIDMNEVSSFIQGSTKGCNVNKLNYPPFTPDILDKLMY
SKTICMDAVQNWGKQYDVHSLYGYSMAIATEQAVQKVFPNKRSFILTRSTFAGSGRHAAH
WLGDNTASWEQMEWSITGMLEFSLFGIPLVGADICGFVAETTEELCRRWMQLGAFYPFSR
NHNSDGYEHQDPAFFGQNSLLVKSSRQYLTIRYTLLPFLYTLFYKAHVFGETVARPVLHE
FYEDTNSWIEDTEFLWGPALLITPVLKQGADTVSAYIPDAIWYDYESGAKRPWRKQRVDM
YLPADKIGLHLRGGYIIPIQEPDVTTTASRKNPLGLIVALGENNTAKGDFFWDDGETKDT
IQNGNYILYTFSVSNNTLDIVCTHSSYQEGTTLAFQTVKILGLTDSVTEVRVAENNQPMN
AHSNFTYDASNQVLLIADLKLNLGRNFSVQWNQIFSENERFNCYPDADLATEQKCTQRGC
VWRTGSSLSKAPECYFPRQDNSYSVNSARYSSMGITADLQLNTANARIKLPSDPISTLRV
EVKYHKNDMLQFKIYDPQKKRYEVPVPLNIPTTPISTYEDRLYDVEIKENPFGIQIRRRS
SGRVIWDSWLPGFAFNDQFIQISTRLPSEYIYGFGEVEHTAFKRDLNWNTWGMFTRDQPP
GYKLNSYGFHPYYMALEEEGNAHGVFLLNSNAMDVTFQPTPALTYRTVGGILDFYMFLGP
TPEVATKQYHEVIGHPVMPAYWALGFQLCRYGYANTSEVRELYDAMVAANIPYDVQYTDI
DYMERQLDFTIGEAFQDLPQFVDKIRGEGMRYIIILDPAISGNETKTYPAFERGQQNDVF
VKWPNTNDICWAKVWPDLPNITIDKTLTEDEAVNASRAHVAFPDFFRTSTAEWWAREIVD
FYNEKMKFDGLWIDMNEPSSFVNGTTTNQCRNDELNYPPYFPELTKRTDGLHFRTICMEA
EQILSDGTSVLHYDVHNLYGWSQMKPTHDALQKTTGKRGIVISRSTYPTSGRWGGHWLGD
NYARWDNMDKSIIGMMEFSLFGMSYTGADICGFFNNSEYHLCTRWMQLGAFYPYSRNHNI
ANTRRQDPASWNETFAEMSRNILNIRYTLLPYFYTQMHEIHANGGTVIRPLLHEFFDEKP
TWDIFKQFLWGPAFMVTPVLEPYVQTVNAYVPNARWFDYHTGKDIGVRGQFQTFNASYDT
INLHVRGGHILPCQEPAQNTFYSRQKHMKLIVAADDNQMAQGSLFWDDGESIDTYERDLY
LSVQFNLNQTTLTSTILKRGYINKSETRLGSLHVWGKGTTPVNAVTLTYNGNKNSLPFNE
DTTNMILRIDLTTHNVTLEEPIEINWS
NT seq 5484 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaaatttagtggattggaaatctctctgattgtcctttttgtcatagtt
actataatagctattgccttaattgttgttttagcaactaagacacctgctgttgatgaa
attagtgattctacttcaactccagctactactcgtgtgactacaaatccttctgattca
ggaaaatgtccaaatgtgttaaatgatcctgtcaatgtgagaataaactgcattccagaa
caattcccaacagagggaatttgtgcacagagaggctgctgctggaggccgtggaatgac
tctcttattccttggtgcttcttcgttgataatcatggttataacgttcaagacatgaca
acaacaagtattggagttgaagccaaattaaacaggataccttcacctacactatttgga
aatgacatcaacagtgttctcttcacaactcaaaatcagacacccaatcgtttccggttc
aagattactgatccaaataatagaagatatgaagttcctcatcagtatgtaaaagagttt
actggacccacagtttctgatacgttgtatgatgtgaaggttgcccaaaacccatttagc
atccaagttattaggaaaagcaacggtaaaactttgtttgacaccagcattggtccctta
gtgtactctgaccagtacttacagatctcaacccgtcttccaagtgattatatttatggt
attggagaacaagttcataagagatttcgtcatgatttatcctggaaaacatggccaatt
tttactcgagaccaacttcctggtgataataataataatttatacggccatcaaacattc
tttatgtgtattgaagatacatctggaaagtcattcggtgtttttttaatgaatagcaat
gcaatggagatttttatccagcctactccaatagtaacatatagagttaccggtggcatt
ctggatttttacatccttctaggagatacaccagaacaagtagttcaacagtatcaacag
cttgttggactaccagcaatgccagcatattggaatcttggattccaactaagtcgctgg
aattataagtcactagatgtagtgaaagaagtggtaaggagaaaccgggaagctggcata
ccatttgatacacaggtcactgatattgactacatggaagacaagaaagactttacttat
gatcaagttgcgtttaacggactccctcaatttgtgcaagatttgcatgaccatggacag
aaatatgtcatcatcttggaccctgcaatttccataggtcgacgtgccaatggaacaaca
tatgcaacctatgagaggggaaacacacaacatgtgtggataaatgagtcagatggaagt
acaccaattattggagaggtatggccaggattaacagtataccctgatttcactaaccca
aactgcattgattggtgggcaaatgaatgcagtattttccatcaagaagtgcaatatgat
ggactttggattgacatgaatgaagtttccagctttattcaaggttcaacaaaaggatgt
aatgtaaacaaattgaattatccaccgtttactcctgatattcttgacaaactcatgtat
tccaaaacaatttgcatggatgctgtgcagaactggggtaaacagtatgatgttcatagc
ctctatggatacagcatggctatagccacagagcaagctgtacaaaaagtttttcctaat
aagagaagcttcattcttacccgctcaacatttgctggatctggaagacatgctgcgcat
tggttaggagacaatactgcttcatgggaacaaatggaatggtctataactggaatgctg
gagttcagtttgtttggaatacctttggttggagcagacatctgtggatttgtggctgaa
accacagaagaactttgcagaagatggatgcaacttggggcattttatccattttccaga
aaccataattctgacggatatgaacatcaggatcctgcattttttgggcagaattcactt
ttggttaaatcatcaaggcagtatttaactattcgctacaccttattacccttcctctac
actctgttttataaagcccatgtgtttggagaaacagtagcaagaccagttcttcatgag
ttttatgaggatacgaacagctggattgaggacactgagtttttgtggggccctgcatta
cttattactcctgttctaaaacagggagcagatactgtgagtgcctacatccctgatgct
atttggtatgattatgaatctggtgcaaaaaggccatggaggaaacaacgggttgatatg
tatcttccagcagacaaaataggattacatcttagaggaggttatatcatccccattcaa
gaaccagatgtaacaacaacagcaagccgtaagaatcctctaggacttatagtcgcatta
ggtgaaaacaacacagccaaaggagactttttctgggatgatggagaaactaaagataca
atacaaaatggcaactacatattatatacattttcagtttctaataacacattagatatt
gtgtgcacacattcatcatatcaggaaggaactaccttagcatttcagactgtaaaaatc
cttgggttgacagacagtgttacagaagttagagtggcggaaaataatcaaccaatgaac
gctcattccaatttcacttatgatgcttctaaccaggttctcctaattgcagatctcaaa
cttaatcttggaagaaactttagtgttcaatggaatcaaattttctcagaaaatgaaaga
tttaattgttatccagatgcagatttggcaactgaacaaaagtgcacacaacgtggctgt
gtatggagaacgggttcttctctatccaaagcacctgagtgttactttcccagacaagat
aactcttattcagtcaactcagctcgctattcatccatgggtataacagctgacctccaa
ctaaatactgcaaatgccagaataaagttaccttctgaccccatctcaactcttcgtgtg
gaggtgaaatatcacaaaaatgatatgttgcagtttaagatttatgatccccaaaagaag
agatatgaagtaccagtaccgttaaacattccaaccaccccaataagtacttatgaagac
agactttatgatgtggaaatcaaggaaaatccttttggcatccagattcgacggagaagc
agtggaagagtcatttgggattcttggctgcctggatttgcttttaatgaccagttcatt
caaatatcgactcgcctgccatcagaatatatatatggttttggggaagtggaacataca
gcatttaagcgagatctgaactggaatacttggggaatgttcacaagagaccaaccccct
ggttacaaacttaattcctatggatttcatccctattacatggctctggaagaggagggc
aatgctcatggtgttttcttactcaacagcaatgcaatggatgttacattccagccaact
cctgctctaacttaccgtacagttggagggatcttggatttttatatgtttttgggccca
actccagaagttgcaacaaagcaataccatgaagtaattggccatccagtcatgccagct
tattgggctttgggattccaattatgtcgttatggatatgcaaatacttcagaggttcgg
gaattatatgacgctatggtggctgctaacatcccctatgatgttcagtacacagacatt
gactacatggaaaggcagctagactttacaattggtgaagcattccaggaccttcctcag
tttgttgacaaaataagaggagaaggaatgagatacattattatcctggatccagcaatt
tcaggaaatgaaacaaagacttaccctgcatttgaaagaggacagcagaatgatgtcttt
gtcaaatggccaaacaccaatgacatttgttgggcaaaggtttggccagatttgcccaac
ataacaatagataaaactctaacggaagatgaagctgttaatgcttccagagctcatgta
gctttcccagatttcttcaggacttccacagcagagtggtgggccagagaaattgtggac
ttttacaatgaaaagatgaagtttgatggtttgtggattgatatgaatgagccatcaagt
tttgtaaatggaacaactactaatcaatgcagaaatgacgaactaaattatccaccttat
ttcccagaactcacaaaaagaactgatggattacatttcagaacaatttgcatggaagct
gagcagattcttagtgatggaacatcagttttgcattacgatgttcacaatctctatgga
tggtcacagatgaaacctactcatgatgcattgcagaagacaactggaaaaagagggatt
gtaatttctcgttccacgtatcctactagtggacgatggggaggacactggcttggagac
aactatgcacgatgggacaacatggacaaatcaatcattggtatgatggaatttagtctg
tttggaatgtcatatactggagcagacatctgtggttttttcaacaactcagaatatcat
ctctgtacccgctggatgcaacttggagcattttatccatactcaaggaatcacaacatt
gcaaatactagaagacaagatcccgcttcctggaatgaaacttttgctgaaatgtcaagg
aatattctaaatattagatacaccttattgccctatttttacacacaaatgcatgaaatt
catgctaatggtggcactgttatccgaccccttttgcatgagttctttgatgaaaaacca
acctgggatatattcaagcagttcttatggggtccagcatttatggttaccccagtactg
gaaccttatgttcaaactgtaaatgcctacgtccccaatgctcggtggtttgactaccat
acaggcaaagatattggcgtcagaggacaatttcaaacatttaatgcttcttatgacaca
ataaacctacatgtccgtggtggtcacatcctaccatgtcaagagccagctcaaaacaca
ttttacagtcgacaaaaacacatgaagctcattgttgctgcagatgataatcagatggca
cagggttctctgttttgggatgatggagagagtatagacacctatgaaagagacctatat
ttatctgtacaatttaatttaaaccagaccaccttaacaagcactatattgaagagaggt
tacataaataaaagtgaaacgaggcttggatcccttcatgtatgggggaaaggaactact
cctgtcaatgcagttactctaacgtataacggaaataaaaattcgcttccttttaatgaa
gacactaccaacatgatattacgtattgatctgaccacacacaatgttactctagaagaa
ccaatagaaatcaactggtcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system