KEGG   Homo sapiens (human): 6497Help
Entry
6497              CDS       T01001                                 

Gene name
SKI, SGS, SKV
Definition
v-ski avian sarcoma viral oncogene homolog
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.33
AA seq 728 aa AA seqDB search
MEAAAGGRGCFQPHPGLQKTLEQFHLSSMSSLGGPAAFSARWAQEAYKKESAKEAGAAAV
PAPVPAATEPPPVLHLPAIQPPPPVLPGPFFMPSDRSTERCETVLEGETISCFVVGGEKR
LCLPQILNSVLRDFSLQQINAVCDELHIYCSRCTADQLEILKVMGILPFSAPSCGLITKT
DAERLCNALLYGGAYPPPCKKELAASLALGLELSERSVRVYHECFGKCKGLLVPELYSSP
SAACIQCLDCRLMYPPHKFVVHSHKALENRTCHWGFDSANWRAYILLSQDYTGKEEQARL
GRCLDDVKEKFDYGNKYKRRVPRVSSEPPASIRPKTDDTSSQSPAPSEKDKPSSWLRTLA
GSSNKSLGCVHPRQRLSAFRPWSPAVSASEKELSPHLPALIRDSFYSYKSFETAVAPNVA
LAPPAQQKVVSSPPCAAAVSRAPEPLATCTQPRKRKLTVDTPGAPETLAPVAAPEEDKDS
EAEVEVESREEFTSSLSSLSSPSFTSSSSAKDLGSPGARALPSAVPDAAAPADAPSGLEA
ELEHLRQALEGGLDTKEAKEKFLHEVVKMRVKQEEKLSAALQAKRSLHQELEFLRVAKKE
KLREATEAKRNLRKEIERLRAENEKKMKEANESRLRLKRELEQARQARVCDKGCEAGRLR
AKYSAQIEDLQVKLQHAEADREQLRADLLREREAREHLEKVVKELQEQLWPRARPEAAGS
EGAAELEP
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggcggcaggcggccgcggctgtttccagccgcacccggggctgcagaagacg
ctggagcagttccacctgagctccatgagctcgctgggcggcccggccgctttctcggcg
cgctgggcgcaggaggcctacaagaaggagagcgccaaggaggcgggcgcggccgcggtg
ccggcgccggtgcccgcagccaccgagccgccgcccgtgctgcacctgcccgccatccag
ccgccgccgcccgtgctgcccgggcccttcttcatgccgtccgaccgctccaccgagcgc
tgcgagaccgtactggaaggcgagaccatctcgtgcttcgtggtgggaggcgagaagcgc
ctgtgtctgccgcagattctcaactcggtgctgcgcgacttctcgctgcagcagatcaac
gcggtgtgcgacgagctccacatctactgctcgcgctgcacggccgaccagctggagatc
ctcaaagtcatgggcatcctgcccttctcggcgccctcgtgcgggctcatcaccaagacg
gacgccgagcgcctgtgcaacgcgctgctctacggcggcgcctacccgccgccctgcaag
aaggagctggccgccagcctggcgctgggcctggagctcagcgagcgcagcgtccgcgtg
taccacgagtgcttcggcaagtgtaaggggctgctggtgcccgagctctacagcagcccg
agcgccgcctgcatccagtgcctggactgccgcctcatgtacccgccgcacaagttcgtg
gtgcactcgcacaaggccctggagaaccggacctgccactggggcttcgactcggccaac
tggcgggcctacatcctgctgagccaggattacacgggcaaggaggagcaggcgcgcctc
ggccgctgcctggacgacgtgaaggagaaattcgactatggcaacaagtacaagcggcgg
gtgccccgggtctcctctgagcctccggcctccataagacccaaaacagatgacacctct
tcccagtcccccgcgccttccgaaaaggacaagccgtccagctggctgcggaccttggcc
ggctcttccaataagagcctgggctgtgttcaccctcgccagcgcctctctgctttccga
ccctggtcccccgcagtgtcagcgagtgagaaagagctctccccacacctcccggccctc
atccgagacagcttctactcctacaagagctttgagacagccgtggcgcccaacgtggcc
ctcgcaccgccggcccagcagaaggttgtgagcagccctccgtgtgccgccgccgtctcc
cgggcccccgagcctctcgccacttgcacccagcctcggaagcggaagctgactgtggac
accccaggagccccagagacgctggcgcccgtggctgccccagaggaggacaaggactcg
gaggcggaggtggaagttgaaagcagggaggaattcacctcctccttgtcctcgctctct
tccccgtcctttacctcatccagctccgccaaggacctgggctccccgggtgcgcgtgcc
ctgccctcggccgtccctgatgctgcggcccctgccgacgcccccagtgggctggaggcg
gagctggagcacctgcggcaggcactggagggcggcctggacaccaaggaagccaaagag
aagttcctgcatgaggtggtcaagatgcgcgtgaagcaggaggagaagctcagcgcagcc
ctgcaggccaagcgcagcctccaccaggagctggagttcctacgcgtggccaagaaggag
aagctgcgggaggccacggaggccaagcgtaacctgcggaaggagatcgagcgtctccgc
gccgagaacgagaagaagatgaaagaggccaacgagtcacggctgcgcctgaagcgggag
ctggagcaggcgcggcaggcccgggtgtgcgacaagggctgcgaggcgggccgcctgcgc
gccaagtactcggcccagatcgaagacctgcaggtgaagctgcagcacgcggaggcggac
cgggagcagctgcgggccgacctgctgcgggagcgcgaggcccgggagcacctggagaag
gtggtgaaggagctgcaggaacagctgtggccgcgggcccgccccgaggctgcgggcagc
gagggcgctgcggagctggagccgtag

DBGET integrated database retrieval system