KEGG   Homo sapiens (human): 6507Help
Entry
6507              CDS       T01001                                 

Gene name
SLC1A3, EA6, EAAT1, GLAST, GLAST1
Definition
solute carrier family 1 (glial high affinity glutamate transporter), member 3
Orthology
K05614  
solute carrier family 1 (glial high affinity glutamate transporter), member 3
Organism
hsa  Homo sapiens (human)
Pathway
Glutamatergic synapse
Disease
H00749  
Episodic ataxias
Class
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:hsa04724]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5p13
AA seq 497 aa AA seqDB search
MTKSNGEEPKMGGRMERFQQGVRKRTLLAKKKVQNITKEDVKSYLFRNAFVLLTVTAVIV
GTILGFTLRPYRMSYREVKYFSFPGELLMRMLQMLVLPLIISSLVTGMAALDSKASGKMG
MRAVVYYMTTTIIAVVIGIIIVIIIHPGKGTKENMHREGKIVRVTAADAFLDLIRNMFPP
NLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPGSVNG
VNALGLVVFSMCFGFVIGNMKEQGQALREFFDSLNEAIMRLVAVIMWYAPVGILFLIAGK
IVEMEDMGVIGGQLAMYTVTVIVGLLIHAVIVLPLLYFLVTRKNPWVFIGGLLQALITAL
GTSSSSATLPITFKCLEENNGVDKRVTRFVLPVGATINMDGTALYEALAAIFIAQVNNFE
LNFGQIITIRDRLRTTTNVLGDSLGAGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQL
IAQDNETEKPIDSETKM
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaagcaatggagaagagcccaagatggggggcaggatggagagattccagcag
ggagtccgtaaacgcacacttttggccaagaagaaagtgcagaacattacaaaggaggat
gttaaaagttacctgtttcggaatgcttttgtgctgctcacagtcaccgctgtcattgtg
ggtacaatccttggatttaccctccgaccatacagaatgagctaccgggaagtcaagtac
ttctcctttcctggggaacttctgatgaggatgttacagatgctggtcttaccacttatc
atctccagtcttgtcacaggaatggcggcgctagatagtaaggcatcagggaagatggga
atgcgagctgtagtctattatatgactaccaccatcattgctgtggtgattggcataatc
attgtcatcatcatccatcctgggaagggcacaaaggaaaacatgcacagagaaggcaaa
attgtacgagtgacagctgcagatgccttcctggacttgatcaggaacatgttccctcca
aatctggtagaagcctgctttaaacagtttaaaaccaactatgagaagagaagctttaaa
gtgcccatccaggccaacgaaacgcttgtgggtgctgtgataaacaatgtgtctgaggcc
atggagactcttacccgaatcacagaggagctggtcccagttccaggatctgtgaatgga
gtcaatgccctgggtctagttgtcttctccatgtgcttcggttttgtgattggaaacatg
aaggaacaggggcaggccctgagagagttctttgattctcttaacgaagccatcatgaga
ctggtagcagtaataatgtggtatgcccccgtgggtattctcttcctgattgctgggaag
attgtggagatggaagacatgggtgtgattggggggcagcttgccatgtacaccgtgact
gtcattgttggcttactcattcacgcagtcatcgtcttgccactcctctacttcttggta
acacggaaaaacccttgggtttttattggagggttgctgcaagcactcatcaccgctctg
gggacctcttcaagttctgccaccctacccatcaccttcaagtgcctggaagagaacaat
ggcgtggacaagcgcgtcaccagattcgtgctccccgtaggagccaccattaacatggat
gggactgccctctatgaggctttggctgccattttcattgctcaagttaacaactttgaa
ctgaacttcggacaaattattacaatcagggatcgcctccggaccaccaccaacgtactg
ggagactccctgggagctgggattgtggagcacttgtcacgacatgaactgaagaacaga
gatgttgaaatgggtaactcagtgattgaagagaatgaaatgaagaaaccatatcaactg
attgcacaggacaatgaaactgagaaacccatcgacagtgaaaccaagatgtag

DBGET integrated database retrieval system