KEGG   Homo sapiens (human): 65125Help
Entry
65125             CDS       T01001                                 

Gene name
WNK1, HSAN2, HSN2, KDP, PPP1R167, PRKWNK1, PSK, p65
Definition
WNK lysine deficient protein kinase 1 (EC:2.7.11.1)
Orthology
K08867  
WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Disease
H00243  
Hyperkalemic distal renal tubular acidosis (RTA type 4)
H00265  
Hereditary sensory and autonomic neuropathy (HSAN)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     65125 (WNK1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  Wnk family
   65125 (WNK1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     65125 (WNK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12p13.3
AA seq 2642 aa AA seqDB search
MSGGAAEKQSSTPGSLFLSPPAPAPKNGSSSDSSVGEKLGAAAADAVTGRTEEYRRRRHT
MDKDSRGAAATTTTTEHRFFRRSVICDSNATALELPGLPLSLPQPSIPAAVPQSAPPEPH
REETVTATATSQVAQQPPAAAAPGEQAVAGPAPSTVPSSTSKDRPVSQPSLVGSKEEPPP
ARSGSGGGSAKEPQEERSQQQDDIEELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLD
TETTVEVAWCELQDRKLTKSERQRFKEEAEMLKGLQHPNIVRFYDSWESTVKGKKCIVLV
TELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGP
TGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEY
PYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQ
EETGVRVELAEEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEM
VESGYVCEGDHKTMAKAIKDRVSLIKRKREQRQLVREEQEKKKQEESSLKQQVEQSSASQ
TGIKQLPSASTGIPTASTTSASVSTQVEPEEPEADQHQQLQYQQPSISVLSDGTVDSGQG
SSVFTESRVSSQQTVSYGSQHEQAHSTGTVPGHIPSTVQAQSQPHGVYPPSSVPQSMAHP
CGGTPTYPESQIFFPTIHERPVSFSPPPTCPPKVAISQRRKSTSFLEAQTHHFQPLLRTV
GQSLLPPGGSPTNWTPEAVVMLGTTASRVTGESCEIQVHPMFEPSQVYSDYRPGLVLPEE
AHYFIPQEAVYVAGVHYQARVAEQYEGIPYNSSVLSSPMKQIPEQKPVQGGPTSSSVFEF
PSGQAFLVGHLQNLRLDSGLGPGSPLSSISAPISTDATRLKFHPVFVPHSAPAVLTHNNE
SRSNCVFEFHVHTPSSSSGEGGGILPQRVYRNRQVAVDLNQEELPPQSVGLHGYLQPVTE
EKHNYHAPELTVSVVEPIGQNWPIGSPEYSSDSSQITSSDPSDFQSPPPTGGAAAPFGSD
VSMPFIHLPQTVLQESPLFFCFPQGTTSQQVLTASFSSGGSALHPQAQGQSQGQPSSSSL
TGVSSSQPIQHPQQQQGIQQTAPPQQTVQYSLSQTSTSSEATTAQPVSQPQAPQVLPQVS
AGKQGFPPRLPPQYPGDSNIAPSSNVASVCIHSTVLSPPMPTEVLATPGYFPTVVQPYVE
SNLLVPMGGVGGQVQVSQPGGSLAQAPTTSSQQAVLESTQGVSQVAPAEPVAVAQTQATQ
PTTLASSVDSAHSDVASGMSDGNENVPSSSGRHEGRTTKRHYRKSVRSRSRHEKTSRPKL
RILNVSNKGDRVVECQLETHNRKMVTFKFDLDGDNPEEIATIMVNNDFILAIERESFVDQ
VREIIEKADEMLSEDVSVEPEGDQGLESLQGKDDYGFSGSQKLEGEFKQPIPASSMPQQI
GIPTSSLTQVVHSAGRRFIVSPVPESRLRESKVFPSEITDTVAASTAQSPGMNLSHSASS
LSLQQAFSELRRAQMTEGPNTAPPNFSHTGPTFPVVPPFLSSIAGVPTTAAATAPVPATS
SPPNDISTSVIQSEVTVPTEEGIAGVATSTGVVTSGGLPIPPVSESPVLSSVVSSITIPA
VVSISTTSPSLQVPTSTSEIVVSSTALYPSVTVSATSASAGGSTATPGPKPPAVVSQQAA
GSTTVGATLTSVSTTTSFPSTASQLCIQLSSSTSTPTLAETVVVSAHSLDKTSHSSTTGL
AFSLSAPSSSSSPGAGVSSYISQPGGLHPLVIPSVIASTPILPQAAGPTSTPLLPQVPSI
PPLVQPVANVPAVQQTLIHSQPQPALLPNQPHTHCPEVDSDTQPKAPGIDDIKTLEEKLR
SLFSEHSSSGAQHASVSLETSLVIESTVTPGIPTTAVAPSKLLTSTTSTCLPPTNLPLGT
VALPVTPVVTPGQVSTPVSTTTSGVKPGTAPSKPPLTKAPVLPVGTELPAGTLPSEQLPP
FPGPSLTQSQQPLEDLDAQLRRTLSPEMITVTSAVGPVSMAAPTAITEAGTQPQKGVSQV
KEGPVLATSSGAGVFKMGRFQVSVAADGAQKEGKNKSEDAKSVHFESSTSESSVLSSSSP
ESTLVKPEPNGITIPGISSDVPESAHKTTASEAKSDTGQPTKVGRFQVTTTANKVGRFSV
SKTEDKITDTKKEGPVASPPFMDLEQAVLPAVIPKKEKPELSEPSHLNGPSSDPEAAFLS
RDVDDGSGSPHSPHQLSSKSLPSQNLSQSLSNSFNSSYMSSDNESDIEDEDLKLELRRLR
DKHLKEIQDLQSRQKHEIESLYTKLGKVPPAVIIPPAAPLSGRRRRPTKSKGSKSSRSSS
LGNKSPQLSGNLSGQSAASVLHPQQTLHPPGNIPESGQNQLLQPLKPSPSSDNLYSAFTS
DGAISVPSLSAPGQGTSSTNTVGATVNSQAAQAQPPAMTSSRKGTFTDDLHKLVDNWARD
AMNLSGRRGSKGHMNYEGPGMARKFSAPGQLCISMTSNLGGSAPISAASATSLGHFTKSM
CPPQQYGFPATPFGAQWSGTGGPAPQPLGQFQPVGTASLQNFNISNLQKSISNPPGSNLR
TT
NT seq 7929 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcggcgccgcagagaagcagagcagcactcccggttccctgttcctctcgccg
ccggctcctgcccccaagaatggctccagctccgattcctccgtgggggagaaactggga
gccgcggccgccgacgctgtgaccggcaggaccgaggagtacaggcgccgccgccacact
atggacaaggacagccgtggggcggccgcgaccactaccaccactgagcaccgcttcttc
cgccggagcgtcatctgtgactccaatgccactgcactggagcttcccggccttcctctt
tccctgccccagcccagcatccccgcggctgtcccgcagagtgctccaccggagccccac
cgggaagagaccgtgaccgccaccgccacttcccaggtagcccagcagcctccagccgct
gccgcccctggggaacaggccgtcgcgggccctgccccctcgactgtccccagcagtacc
agcaaagaccgcccagtgtcccagcctagccttgtggggagcaaagaggagccgccgccg
gcgagaagtggcagcggcggcggcagcgccaaggagccacaggaggaacggagccagcag
caggatgatatcgaagagctggagaccaaggccgtgggaatgtctaacgatggccgcttt
ctcaagtttgacatcgaaatcggcagaggctcctttaagacggtctacaaaggtctggac
actgaaaccaccgtggaagtcgcctggtgtgaactgcaggatcgaaaattaacaaagtct
gagaggcagagatttaaagaagaagctgaaatgttaaaaggtcttcagcatcccaatatt
gttagattttatgattcctgggaatccacagtaaaaggaaagaagtgcattgttttggtg
actgaacttatgacgtctggaacacttaaaacgtatctgaaaaggtttaaagtgatgaag
atcaaagttctaagaagctggtgccgtcagatccttaaaggtcttcagtttcttcatact
cgaactccacctatcattcaccgcgatcttaaatgtgacaacatctttatcaccggccct
actggctcagtcaagattggagacctcggtctggcaaccctgaagcgggcttcttttgcc
aagagtgtgataggtaccccagagttcatggcccctgagatgtatgaggagaaatatgat
gaatccgttgacgtttatgcttttgggatgtgcatgcttgagatggctacatctgaatat
ccttactcggagtgccaaaatgctgcacagatctaccgtcgcgtgaccagtggggtgaag
ccagccagttttgacaaagtagcaattcctgaagtgaaggaaattattgaaggatgcata
cgacaaaacaaagatgaaagatattccatcaaagaccttttgaaccatgccttcttccaa
gaggaaacaggagtacgggtagaattagcagaagaagatgatggagaaaaaatagccata
aaattatggctacgtattgaagatattaagaaattaaagggaaaatacaaagataatgaa
gctattgagttttcttttgatttagagagagatgtcccagaagatgttgcacaagaaatg
gtagagtctgggtatgtctgtgaaggtgatcacaagaccatggctaaagctatcaaagac
agagtatcattaattaagaggaaacgagagcagcggcagttggtacgggaggagcaagaa
aaaaaaaagcaggaagagagcagtctcaaacagcaggtagaacaatccagtgcttcccag
acaggaatcaagcagctcccttctgctagcaccggcatacctactgcttctaccacttca
gcttcagtttctacacaagtagaacctgaagaacctgaggcagatcaacatcaacaacta
cagtaccagcaacccagtatatctgtgttatctgatgggacggttgacagtggtcaggga
tcctctgtcttcacagaatctcgagtgagcagccaacagacagtttcatatggttcccaa
catgaacaggcacattctacaggcacagtcccagggcatataccttctactgtccaagca
cagtctcagccccatggggtatatccaccctcaagtgtgcctcagtccatggcgcatccg
tgtggggggaccccaacatacccagaatcacagatatttttcccaactattcatgaacgt
ccagtttctttttcaccacctcccacctgcccaccgaaagtagccatttcccagcggcgt
aagagcacctccttcctggaagcccaaactcaccacttccaacccctgctgaggactgtt
ggccaaagtcttcttccacctggtggcagcccaactaactggacaccagaggccgtagtt
atgttgggtactacagccagtagagtaactggagagtcatgtgagatacaggtccatcct
atgtttgaaccatctcaagtttacagtgactatagacctggactagtacttccagaagaa
gctcactattttattcctcaggaagcagtgtatgtagctggggtacattaccaggcccgg
gtggcagaacagtatgagggcattccatacaactcatcagtactgtcaagtcctatgaaa
cagatacctgaacagaagccagtacaagggggccctacttcaagttctgtctttgaattt
ccatctggacaggctttcctggtaggacaccttcagaatctaagattagattctggattg
ggtccgggatctcccctctctagtatttctgcacctatcagtacagatgctacacgtttg
aaatttcaccctgtctttgttcctcattctgcgcctgctgtgttaactcataacaatgag
agcagaagcaactgtgtatttgaatttcatgttcacacaccaagctcctcttcaggagaa
ggaggtggaattttacctcagcgtgtttaccgaaatcggcaggttgcagtggacttgaat
caagaagaactgcctcctcaatcagttggattacatggctacttgcagcctgtgactgaa
gaaaagcataattaccatgccccagaattgaccgtttctgtggtagagcctatcggacag
aactggccaataggaagcccagaatattccagtgattcctcacaaatcacttcttcagac
cccagtgattttcagtcacctccccctacagggggagcagctgcaccttttggctctgac
gtctcaatgccctttatccatctgcctcagacagtgttacaagaatccccacttttcttc
tgtttcccccaaggaaccacatctcagcaggtcttaactgcctcattttcttcaggagga
tctgcacttcatccacaggcacaggggcagagccagggtcagccatcctcaagtagctta
acaggggtttcatcttcccaacccatacaacatcctcagcagcagcagggaatacagcag
acagcccctcctcaacagacagtgcagtattcactttcacagacatcaacctccagtgag
gccactactgcacagccagtgagtcagcctcaagctccacaagtcttgcctcaagtatca
gctggaaaacagggcttcccacctcgactgccaccacagtacccaggagattcaaatatt
gctccctcttccaacgtggcttctgtttgcatccattctacagtcctatcccctcccatg
ccgacagaagtactggctacacctgggtactttcccacagtggtgcagccttatgtggaa
tcaaatcttttagttcctatgggtggtgtaggaggacaggttcaagtgtcccagccagga
gggagtttagcacaagcccccactacatcctcccagcaagcagttttggagagtactcag
ggagtctctcaggttgctcctgcagagccagttgcagtagcacagacccaagctacccag
ccgaccactttggcttcctctgtagacagtgcacattcagatgttgcttcaggtatgagt
gatggcaatgagaacgtcccatcttccagtggaaggcatgaaggaagaactacaaaacgg
cattaccgaaaatctgtaaggagtcgctctcgacatgaaaaaacttcacgcccaaaatta
agaattttgaatgtttcaaataaaggagaccgagtagtagaatgtcaattagagactcat
aataggaaaatggttacattcaaatttgacctagatggtgacaaccccgaggagatagca
acaattatggtgaacaatgactttattctagcaatagagagagagtcgtttgtggatcaa
gtgcgagaaattattgaaaaagctgatgaaatgctcagtgaggatgtcagtgtggaacca
gagggtgatcagggattggagagtctacaaggaaaggatgactatggcttttcaggttct
cagaaattggaaggagagttcaaacaaccaattcctgcgtcttccatgccacagcaaata
ggcattcctaccagttctttaactcaagttgttcattctgcgggaaggcggtttatagtg
agtcctgtgccagaaagccgattacgagaatcaaaagttttccccagtgaaataacagat
acagttgctgcctctacagctcagagccctggaatgaacttgtctcactctgcatcatcc
cttagtctacaacaggccttttctgaacttagacgtgcccaaatgacagaaggacccaac
acagcacctccaaactttagtcatacaggaccaacatttccagtagtacctcctttctta
agtagcattgctggagtcccaaccacagcagcagccacagcaccagtccctgcaacaagc
agccctcctaatgacatttccacatcagtaattcagtctgaggttacagtgcccactgaa
gaggggattgctggagttgccaccagcacaggtgtggtaacttcaggtggtctccccata
ccacctgtgtctgaatcaccagtactttccagcgtagtttcaagtatcacaatacctgca
gttgtctcaatatctactacatccccgtcacttcaagtccccacatccacatctgagatc
gttgtttctagtacagcactgtatccttcagtaacagtttcagcaacttcagcctctgca
gggggcagtactgctaccccaggtcctaagcctccagctgtagtatctcagcaggcagca
ggcagcactactgtgggagccacattaacatcagtttctaccaccacttcattcccaagc
acagcttcacagctgtgcattcagcttagcagcagtacttctactcctactttagctgaa
accgtggtagttagcgcacactcactagataagacatctcatagcagtacaactggattg
gctttctccctctctgcaccatcttcctcttcctctcctggagcaggagtgtctagttat
atttctcagcctggtgggctgcatcctttggtcattccatcagtgatagcttctactcct
attcttccccaagcagcaggacctacttctacacctttattaccccaagtacctagtatc
ccacccttggtacagcctgttgccaatgtgcctgctgtacagcagacactaattcatagt
cagcctcaaccagctttgcttcccaaccagccccatactcattgtcctgaagtagattct
gatacacaacccaaagctcctggaattgatgacataaagactctagaagaaaagctgcgg
tctctgttcagtgaacacagctcatctggagctcagcatgcctctgtctcactggagacc
tcactagtcatagagagcactgtcacaccaggcatcccaactactgctgttgcaccaagc
aaactcctgacttctaccacaagtacttgcttaccaccaaccaatttaccactaggaaca
gttgctttgccagttacaccagtggtcacacctgggcaagtttctaccccagtcagcact
actacatcaggagtgaaacctggaactgctccctccaagccacctctaactaaggctccg
gtgctgccagtgggtactgaacttccagcaggtactctacccagcgagcagctgccacct
tttccaggaccttctctaacccagtcccagcaacctctagaggatcttgatgctcaattg
agaagaacacttagtccagagatgatcacagtgacttctgcggttggtcctgtgtccatg
gcggctccaacagcaatcacagaagcaggaacacagcctcagaagggtgtttctcaagtc
aaagaaggccctgtcctagcaactagttcaggagctggtgtttttaagatgggacgattt
caggtttctgttgcagcagacggtgcccagaaagagggtaaaaataagtcagaagatgca
aagtctgttcattttgaatccagcacctcagagtcctcagtgctatcaagtagtagtcca
gagagtaccttggtgaaaccagagccgaatggcataaccatccctggtatctcttcagat
gtgccagagagtgcccacaaaactactgcctcagaggcaaagtcagacactgggcagcct
accaaggttggacgttttcaggtgacaactacagcaaacaaagtgggtcgtttctctgta
tcaaaaactgaggacaagatcactgacacaaagaaagaaggaccagtggcatctcctcct
tttatggatttggaacaagctgttcttcctgctgtgataccaaagaaagagaagcctgaa
ctgtcagagccttcacatctaaatgggccgtcttctgacccggaggccgcttttttaagt
agggatgtggatgatggttccggtagtccacactcgccccatcagctgagctcaaagagc
cttcctagccagaatctaagtcaaagccttagtaattcatttaactcctcttacatgagt
agcgacaatgagtcagatatcgaagatgaagacttaaagttagagctgcgacgactacga
gataaacatctcaaagagattcaggacctgcagagtcgccagaagcatgaaattgaatct
ttgtataccaaactgggcaaggtgccccctgctgttattattcccccagctgctcccctt
tcagggagaagacgacgacccactaaaagcaaaggcagcaaatctagtcgaagcagttcc
ttggggaataaaagcccccagctttcaggtaacctgtctggtcagagtgcagcttcagtc
ttgcacccccagcagaccctccaccctcctggcaacatcccagagtccgggcagaatcag
ctgttacagccccttaagccatctccctccagtgacaacctctattcagccttcaccagt
gatggtgccatttcagtaccaagcctttctgctccaggtcaaggaaccagcagcacaaac
actgttggggcaacagtgaacagccaagccgcccaagctcagcctcctgccatgacgtcc
agcaggaagggcacattcacagatgacttgcacaagttggtagacaattgggcccgagat
gccatgaatctctcaggcaggagaggaagcaaagggcacatgaattacgagggccctgga
atggcaaggaagttctctgcacctgggcaactgtgcatctccatgacctcgaacctgggt
ggctctgcccccatctctgcagcatcagctacctctctaggtcacttcaccaagtctatg
tgccccccacagcagtatggctttccagctaccccatttggcgctcaatggagtgggacg
ggtggcccagcaccacagccacttggccagttccaacctgtgggaactgcctccttgcag
aatttcaacatcagcaatttgcagaaatccatcagcaaccccccaggctccaacctgcgg
accacttag

  All links  
No link information was found.   
DBGET integrated database retrieval system