KEGG   Homo sapiens (human): 65125Help
Entry
65125             CDS       T01001                                 

Gene name
WNK1, HSAN2, HSN2, KDP, PRKWNK1, PSK, p65
Definition
WNK lysine deficient protein kinase 1 (EC:2.7.11.1)
Orthology
K08867  
WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Disease
H00243  
Hyperkalemic distal renal tubular acidosis (RTA type 4)
H00265  
Hereditary sensory and autonomic neuropathy (HSAN)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12p13.3
AA seq 2642 aa AA seqDB search
MSGGAAEKQSSTPGSLFLSPPAPAPKNGSSSDSSVGEKLGAAAADAVTGRTEEYRRRRHT
MDKDSRGAAATTTTTEHRFFRRSVICDSNATALELPGLPLSLPQPSIPAAVPQSAPPEPH
REETVTATATSQVAQQPPAAAAPGEQAVAGPAPSTVPSSTSKDRPVSQPSLVGSKEEPPP
ARSGSGGGSAKEPQEERSQQQDDIEELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLD
TETTVEVAWCELQDRKLTKSERQRFKEEAEMLKGLQHPNIVRFYDSWESTVKGKKCIVLV
TELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGP
TGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEY
PYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQ
EETGVRVELAEEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEM
VESGYVCEGDHKTMAKAIKDRVSLIKRKREQRQLVREEQEKKKQEESSLKQQVEQSSASQ
TGIKQLPSASTGIPTASTTSASVSTQVEPEEPEADQHQQLQYQQPSISVLSDGTVDSGQG
SSVFTESRVSSQQTVSYGSQHEQAHSTGTVPGHIPSTVQAQSQPHGVYPPSSVPQSMAHP
CGGTPTYPESQIFFPTIHERPVSFSPPPTCPPKVAISQRRKSTSFLEAQTHHFQPLLRTV
GQSLLPPGGSPTNWTPEAVVMLGTTASRVTGESCEIQVHPMFEPSQVYSDYRPGLVLPEE
AHYFIPQEAVYVAGVHYQARVAEQYEGIPYNSSVLSSPMKQIPEQKPVQGGPTSSSVFEF
PSGQAFLVGHLQNLRLDSGLGPGSPLSSISAPISTDATRLKFHPVFVPHSAPAVLTHNNE
SRSNCVFEFHVHTPSSSSGEGGGILPQRVYRNRQVAVDLNQEELPPQSVGLHGYLQPVTE
EKHNYHAPELTVSVVEPIGQNWPIGSPEYSSDSSQITSSDPSDFQSPPPTGGAAAPFGSD
VSMPFIHLPQTVLQESPLFFCFPQGTTSQQVLTASFSSGGSALHPQAQGQSQGQPSSSSL
TGVSSSQPIQHPQQQQGIQQTAPPQQTVQYSLSQTSTSSEATTAQPVSQPQAPQVLPQVS
AGKQGFPPRLPPQYPGDSNIAPSSNVASVCIHSTVLSPPMPTEVLATPGYFPTVVQPYVE
SNLLVPMGGVGGQVQVSQPGGSLAQAPTTSSQQAVLESTQGVSQVAPAEPVAVAQTQATQ
PTTLASSVDSAHSDVASGMSDGNENVPSSSGRHEGRTTKRHYRKSVRSRSRHEKTSRPKL
RILNVSNKGDRVVECQLETHNRKMVTFKFDLDGDNPEEIATIMVNNDFILAIERESFVDQ
VREIIEKADEMLSEDVSVEPEGDQGLESLQGKDDYGFSGSQKLEGEFKQPIPASSMPQQI
GIPTSSLTQVVHSAGRRFIVSPVPESRLRESKVFPSEITDTVAASTAQSPGMNLSHSASS
LSLQQAFSELRRAQMTEGPNTAPPNFSHTGPTFPVVPPFLSSIAGVPTTAAATAPVPATS
SPPNDISTSVIQSEVTVPTEEGIAGVATSTGVVTSGGLPIPPVSESPVLSSVVSSITIPA
VVSISTTSPSLQVPTSTSEIVVSSTALYPSVTVSATSASAGGSTATPGPKPPAVVSQQAA
GSTTVGATLTSVSTTTSFPSTASQLCIQLSSSTSTPTLAETVVVSAHSLDKTSHSSTTGL
AFSLSAPSSSSSPGAGVSSYISQPGGLHPLVIPSVIASTPILPQAAGPTSTPLLPQVPSI
PPLVQPVANVPAVQQTLIHSQPQPALLPNQPHTHCPEVDSDTQPKAPGIDDIKTLEEKLR
SLFSEHSSSGAQHASVSLETSLVIESTVTPGIPTTAVAPSKLLTSTTSTCLPPTNLPLGT
VALPVTPVVTPGQVSTPVSTTTSGVKPGTAPSKPPLTKAPVLPVGTELPAGTLPSEQLPP
FPGPSLTQSQQPLEDLDAQLRRTLSPEMITVTSAVGPVSMAAPTAITEAGTQPQKGVSQV
KEGPVLATSSGAGVFKMGRFQVSVAADGAQKEGKNKSEDAKSVHFESSTSESSVLSSSSP
ESTLVKPEPNGITIPGISSDVPESAHKTTASEAKSDTGQPTKVGRFQVTTTANKVGRFSV
SKTEDKITDTKKEGPVASPPFMDLEQAVLPAVIPKKEKPELSEPSHLNGPSSDPEAAFLS
RDVDDGSGSPHSPHQLSSKSLPSQNLSQSLSNSFNSSYMSSDNESDIEDEDLKLELRRLR
DKHLKEIQDLQSRQKHEIESLYTKLGKVPPAVIIPPAAPLSGRRRRPTKSKGSKSSRSSS
LGNKSPQLSGNLSGQSAASVLHPQQTLHPPGNIPESGQNQLLQPLKPSPSSDNLYSAFTS
DGAISVPSLSAPGQGTSSTNTVGATVNSQAAQAQPPAMTSSRKGTFTDDLHKLVDNWARD
AMNLSGRRGSKGHMNYEGPGMARKFSAPGQLCISMTSNLGGSAPISAASATSLGHFTKSM
CPPQQYGFPATPFGAQWSGTGGPAPQPLGQFQPVGTASLQNFNISNLQKSISNPPGSNLR
TT
NT seq 7929 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcggcgccgcagagaagcagagcagcactcccggttccctgttcctctcgccg
ccggctcctgcccccaagaatggctccagctccgattcctccgtgggggagaaactggga
gccgcggccgccgacgctgtgaccggcaggaccgaggagtacaggcgccgccgccacact
atggacaaggacagccgtggggcggccgcgaccactaccaccactgagcaccgcttcttc
cgccggagcgtcatctgtgactccaatgccactgcactggagcttcccggccttcctctt
tccctgccccagcccagcatccccgcggctgtcccgcagagtgctccaccggagccccac
cgggaagagaccgtgaccgccaccgccacttcccaggtagcccagcagcctccagccgct
gccgcccctggggaacaggccgtcgcgggccctgccccctcgactgtccccagcagtacc
agcaaagaccgcccagtgtcccagcctagccttgtggggagcaaagaggagccgccgccg
gcgagaagtggcagcggcggcggcagcgccaaggagccacaggaggaacggagccagcag
caggatgatatcgaagagctggagaccaaggccgtgggaatgtctaacgatggccgcttt
ctcaagtttgacatcgaaatcggcagaggctcctttaagacggtctacaaaggtctggac
actgaaaccaccgtggaagtcgcctggtgtgaactgcaggatcgaaaattaacaaagtct
gagaggcagagatttaaagaagaagctgaaatgttaaaaggtcttcagcatcccaatatt
gttagattttatgattcctgggaatccacagtaaaaggaaagaagtgcattgttttggtg
actgaacttatgacgtctggaacacttaaaacgtatctgaaaaggtttaaagtgatgaag
atcaaagttctaagaagctggtgccgtcagatccttaaaggtcttcagtttcttcatact
cgaactccacctatcattcaccgcgatcttaaatgtgacaacatctttatcaccggccct
actggctcagtcaagattggagacctcggtctggcaaccctgaagcgggcttcttttgcc
aagagtgtgataggtaccccagagttcatggcccctgagatgtatgaggagaaatatgat
gaatccgttgacgtttatgcttttgggatgtgcatgcttgagatggctacatctgaatat
ccttactcggagtgccaaaatgctgcacagatctaccgtcgcgtgaccagtggggtgaag
ccagccagttttgacaaagtagcaattcctgaagtgaaggaaattattgaaggatgcata
cgacaaaacaaagatgaaagatattccatcaaagaccttttgaaccatgccttcttccaa
gaggaaacaggagtacgggtagaattagcagaagaagatgatggagaaaaaatagccata
aaattatggctacgtattgaagatattaagaaattaaagggaaaatacaaagataatgaa
gctattgagttttcttttgatttagagagagatgtcccagaagatgttgcacaagaaatg
gtagagtctgggtatgtctgtgaaggtgatcacaagaccatggctaaagctatcaaagac
agagtatcattaattaagaggaaacgagagcagcggcagttggtacgggaggagcaagaa
aaaaaaaagcaggaagagagcagtctcaaacagcaggtagaacaatccagtgcttcccag
acaggaatcaagcagctcccttctgctagcaccggcatacctactgcttctaccacttca
gcttcagtttctacacaagtagaacctgaagaacctgaggcagatcaacatcaacaacta
cagtaccagcaacccagtatatctgtgttatctgatgggacggttgacagtggtcaggga
tcctctgtcttcacagaatctcgagtgagcagccaacagacagtttcatatggttcccaa
catgaacaggcacattctacaggcacagtcccagggcatataccttctactgtccaagca
cagtctcagccccatggggtatatccaccctcaagtgtgcctcagtccatggcgcatccg
tgtggggggaccccaacatacccagaatcacagatatttttcccaactattcatgaacgt
ccagtttctttttcaccacctcccacctgcccaccgaaagtagccatttcccagcggcgt
aagagcacctccttcctggaagcccaaactcaccacttccaacccctgctgaggactgtt
ggccaaagtcttcttccacctggtggcagcccaactaactggacaccagaggccgtagtt
atgttgggtactacagccagtagagtaactggagagtcatgtgagatacaggtccatcct
atgtttgaaccatctcaagtttacagtgactatagacctggactagtacttccagaagaa
gctcactattttattcctcaggaagcagtgtatgtagctggggtacattaccaggcccgg
gtggcagaacagtatgagggcattccatacaactcatcagtactgtcaagtcctatgaaa
cagatacctgaacagaagccagtacaagggggccctacttcaagttctgtctttgaattt
ccatctggacaggctttcctggtaggacaccttcagaatctaagattagattctggattg
ggtccgggatctcccctctctagtatttctgcacctatcagtacagatgctacacgtttg
aaatttcaccctgtctttgttcctcattctgcgcctgctgtgttaactcataacaatgag
agcagaagcaactgtgtatttgaatttcatgttcacacaccaagctcctcttcaggagaa
ggaggtggaattttacctcagcgtgtttaccgaaatcggcaggttgcagtggacttgaat
caagaagaactgcctcctcaatcagttggattacatggctacttgcagcctgtgactgaa
gaaaagcataattaccatgccccagaattgaccgtttctgtggtagagcctatcggacag
aactggccaataggaagcccagaatattccagtgattcctcacaaatcacttcttcagac
cccagtgattttcagtcacctccccctacagggggagcagctgcaccttttggctctgac
gtctcaatgccctttatccatctgcctcagacagtgttacaagaatccccacttttcttc
tgtttcccccaaggaaccacatctcagcaggtcttaactgcctcattttcttcaggagga
tctgcacttcatccacaggcacaggggcagagccagggtcagccatcctcaagtagctta
acaggggtttcatcttcccaacccatacaacatcctcagcagcagcagggaatacagcag
acagcccctcctcaacagacagtgcagtattcactttcacagacatcaacctccagtgag
gccactactgcacagccagtgagtcagcctcaagctccacaagtcttgcctcaagtatca
gctggaaaacagggcttcccacctcgactgccaccacagtacccaggagattcaaatatt
gctccctcttccaacgtggcttctgtttgcatccattctacagtcctatcccctcccatg
ccgacagaagtactggctacacctgggtactttcccacagtggtgcagccttatgtggaa
tcaaatcttttagttcctatgggtggtgtaggaggacaggttcaagtgtcccagccagga
gggagtttagcacaagcccccactacatcctcccagcaagcagttttggagagtactcag
ggagtctctcaggttgctcctgcagagccagttgcagtagcacagacccaagctacccag
ccgaccactttggcttcctctgtagacagtgcacattcagatgttgcttcaggtatgagt
gatggcaatgagaacgtcccatcttccagtggaaggcatgaaggaagaactacaaaacgg
cattaccgaaaatctgtaaggagtcgctctcgacatgaaaaaacttcacgcccaaaatta
agaattttgaatgtttcaaataaaggagaccgagtagtagaatgtcaattagagactcat
aataggaaaatggttacattcaaatttgacctagatggtgacaaccccgaggagatagca
acaattatggtgaacaatgactttattctagcaatagagagagagtcgtttgtggatcaa
gtgcgagaaattattgaaaaagctgatgaaatgctcagtgaggatgtcagtgtggaacca
gagggtgatcagggattggagagtctacaaggaaaggatgactatggcttttcaggttct
cagaaattggaaggagagttcaaacaaccaattcctgcgtcttccatgccacagcaaata
ggcattcctaccagttctttaactcaagttgttcattctgcgggaaggcggtttatagtg
agtcctgtgccagaaagccgattacgagaatcaaaagttttccccagtgaaataacagat
acagttgctgcctctacagctcagagccctggaatgaacttgtctcactctgcatcatcc
cttagtctacaacaggccttttctgaacttagacgtgcccaaatgacagaaggacccaac
acagcacctccaaactttagtcatacaggaccaacatttccagtagtacctcctttctta
agtagcattgctggagtcccaaccacagcagcagccacagcaccagtccctgcaacaagc
agccctcctaatgacatttccacatcagtaattcagtctgaggttacagtgcccactgaa
gaggggattgctggagttgccaccagcacaggtgtggtaacttcaggtggtctccccata
ccacctgtgtctgaatcaccagtactttccagcgtagtttcaagtatcacaatacctgca
gttgtctcaatatctactacatccccgtcacttcaagtccccacatccacatctgagatc
gttgtttctagtacagcactgtatccttcagtaacagtttcagcaacttcagcctctgca
gggggcagtactgctaccccaggtcctaagcctccagctgtagtatctcagcaggcagca
ggcagcactactgtgggagccacattaacatcagtttctaccaccacttcattcccaagc
acagcttcacagctgtgcattcagcttagcagcagtacttctactcctactttagctgaa
accgtggtagttagcgcacactcactagataagacatctcatagcagtacaactggattg
gctttctccctctctgcaccatcttcctcttcctctcctggagcaggagtgtctagttat
atttctcagcctggtgggctgcatcctttggtcattccatcagtgatagcttctactcct
attcttccccaagcagcaggacctacttctacacctttattaccccaagtacctagtatc
ccacccttggtacagcctgttgccaatgtgcctgctgtacagcagacactaattcatagt
cagcctcaaccagctttgcttcccaaccagccccatactcattgtcctgaagtagattct
gatacacaacccaaagctcctggaattgatgacataaagactctagaagaaaagctgcgg
tctctgttcagtgaacacagctcatctggagctcagcatgcctctgtctcactggagacc
tcactagtcatagagagcactgtcacaccaggcatcccaactactgctgttgcaccaagc
aaactcctgacttctaccacaagtacttgcttaccaccaaccaatttaccactaggaaca
gttgctttgccagttacaccagtggtcacacctgggcaagtttctaccccagtcagcact
actacatcaggagtgaaacctggaactgctccctccaagccacctctaactaaggctccg
gtgctgccagtgggtactgaacttccagcaggtactctacccagcgagcagctgccacct
tttccaggaccttctctaacccagtcccagcaacctctagaggatcttgatgctcaattg
agaagaacacttagtccagagatgatcacagtgacttctgcggttggtcctgtgtccatg
gcggctccaacagcaatcacagaagcaggaacacagcctcagaagggtgtttctcaagtc
aaagaaggccctgtcctagcaactagttcaggagctggtgtttttaagatgggacgattt
caggtttctgttgcagcagacggtgcccagaaagagggtaaaaataagtcagaagatgca
aagtctgttcattttgaatccagcacctcagagtcctcagtgctatcaagtagtagtcca
gagagtaccttggtgaaaccagagccgaatggcataaccatccctggtatctcttcagat
gtgccagagagtgcccacaaaactactgcctcagaggcaaagtcagacactgggcagcct
accaaggttggacgttttcaggtgacaactacagcaaacaaagtgggtcgtttctctgta
tcaaaaactgaggacaagatcactgacacaaagaaagaaggaccagtggcatctcctcct
tttatggatttggaacaagctgttcttcctgctgtgataccaaagaaagagaagcctgaa
ctgtcagagccttcacatctaaatgggccgtcttctgacccggaggccgcttttttaagt
agggatgtggatgatggttccggtagtccacactcgccccatcagctgagctcaaagagc
cttcctagccagaatctaagtcaaagccttagtaattcatttaactcctcttacatgagt
agcgacaatgagtcagatatcgaagatgaagacttaaagttagagctgcgacgactacga
gataaacatctcaaagagattcaggacctgcagagtcgccagaagcatgaaattgaatct
ttgtataccaaactgggcaaggtgccccctgctgttattattcccccagctgctcccctt
tcagggagaagacgacgacccactaaaagcaaaggcagcaaatctagtcgaagcagttcc
ttggggaataaaagcccccagctttcaggtaacctgtctggtcagagtgcagcttcagtc
ttgcacccccagcagaccctccaccctcctggcaacatcccagagtccgggcagaatcag
ctgttacagccccttaagccatctccctccagtgacaacctctattcagccttcaccagt
gatggtgccatttcagtaccaagcctttctgctccaggtcaaggaaccagcagcacaaac
actgttggggcaacagtgaacagccaagccgcccaagctcagcctcctgccatgacgtcc
agcaggaagggcacattcacagatgacttgcacaagttggtagacaattgggcccgagat
gccatgaatctctcaggcaggagaggaagcaaagggcacatgaattacgagggccctgga
atggcaaggaagttctctgcacctgggcaactgtgcatctccatgacctcgaacctgggt
ggctctgcccccatctctgcagcatcagctacctctctaggtcacttcaccaagtctatg
tgccccccacagcagtatggctttccagctaccccatttggcgctcaatggagtgggacg
ggtggcccagcaccacagccacttggccagttccaacctgtgggaactgcctccttgcag
aatttcaacatcagcaatttgcagaaatccatcagcaaccccccaggctccaacctgcgg
accacttag

DBGET integrated database retrieval system