KEGG   Homo sapiens (human): 6523Help
Entry
6523              CDS       T01001                                 

Gene name
SLC5A1, D22S675, NAGT, SGLT1
Definition
solute carrier family 5 (sodium/glucose cotransporter), member 1
Orthology
K14158  
solute carrier family 5 (sodium/glucose cotransporter), member 1
Organism
hsa  Homo sapiens (human)
Pathway
Carbohydrate digestion and absorption
Bile secretion
Mineral absorption
Disease
H01261  
Congenital glucose-galactose malabsorption (GGM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04976 Bile secretion
    6523 (SLC5A1)
   04973 Carbohydrate digestion and absorption
    6523 (SLC5A1)
   04978 Mineral absorption
    6523 (SLC5A1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   6523 (SLC5A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q12.3
AA seq 664 aa AA seqDB search
MDSSTWSPKTTAVTRPVETHELIRNAADISIIVIYFVVVMAVGLWAMFSTNRGTVGGFFL
AGRSMVWWPIGASLFASNIGSGHFVGLAGTGAASGIAIGGFEWNALVLVVVLGWLFVPIY
IKAGVVTMPEYLRKRFGGQRIQVYLSLLSLLLYIFTKISADIFSGAIFINLALGLNLYLA
IFLLLAITALYTITGGLAAVIYTDTLQTVIMLVGSLILTGFAFHEVGGYDAFMEKYMKAI
PTIVSDGNTTFQEKCYTPRADSFHIFRDPLTGDLPWPGFIFGMSILTLWYWCTDQVIVQR
CLSAKNMSHVKGGCILCGYLKLMPMFIMVMPGMISRILYTEKIACVVPSECEKYCGTKVG
CTNIAYPTLVVELMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDIYAKVRKRASEK
ELMIAGRLFILVLIGISIAWVPIVQSAQSGQLFDYIQSITSYLGPPIAAVFLLAIFWKRV
NEPGAFWGLILGLLIGISRMITEFAYGTGSCMEPSNCPTIICGVHYLYFAIILFAISFIT
IVVISLLTKPIPDVHLYRLCWSLRNSKEERIDLDAEEENIQEGPKETIEIETQVPEKKKG
IFRRAYDLFCGLEQHGAPKMTEEEEKAMKMKMTDTSEKPLWRTVLNVNGIILVTVAVFCH
AYFA
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggacagtagcacctggagccccaagaccaccgcggtcacccggcctgttgagacccac
gagctcattcgcaatgcagccgatatctccatcatcgttatctacttcgtggtagtgatg
gccgtcggactgtgggctatgttttccaccaatcgtgggactgttggaggcttcttcctg
gcaggccgaagtatggtgtggtggccgattggagcctccctctttgctagtaacattgga
agtggccactttgtggggctggccgggactggggcagcttcaggcatcgccattggaggc
tttgaatggaatgccctggttttggtggttgtgctgggctggctgtttgtccccatctat
attaaggctggggtggtgacaatgccagagtacctgaggaagcggtttggaggccagcgg
atccaggtctacctttcccttctgtccctgctgctctacattttcaccaagatctcggca
gacatcttctcgggggccatattcatcaatctggccttaggcctgaatctgtatttagcc
atctttctcttattggcaatcactgccctttacacaattacagggggcctggcggcggtg
atttacacggacaccttgcagacggtgatcatgctggtggggtctttaatcctgactggg
tttgcttttcacgaagtgggaggctatgacgccttcatggaaaagtacatgaaagccatt
ccaaccatagtgtctgatggcaacaccacctttcaggaaaaatgctacactccaagggcc
gactccttccacatcttccgagatcccctcacgggagacctcccatggcctgggttcatc
tttgggatgtccatccttaccttgtggtactggtgcacagatcaggtcattgtgcagcgc
tgcctctcagccaagaatatgtctcacgtgaagggtggctgcatcctgtgtgggtatcta
aagctgatgcccatgttcatcatggtgatgccaggaatgatcagccgcattctgtacaca
gaaaaaattgcctgtgtcgtcccttcagaatgtgagaaatattgcggtaccaaggttggc
tgtaccaacatcgcctatccaaccttagtggtggagctcatgcccaatggactgcgaggc
ctgatgctatcagtcatgctggcctccctcatgagctccctgacctccatcttcaacagc
gccagcaccctcttcaccatggacatctacgccaaggtccgcaagagagcatctgagaaa
gagctcatgattgccggaaggttgtttatcctggtgctgattggcatcagcatcgcctgg
gtgcccattgtgcagtcagcacaaagtgggcaactcttcgattacatccagtccatcacc
agttacttgggaccacccattgcggctgtcttcctgcttgctattttctggaagagagtc
aatgagccaggagccttttggggactgatcctaggacttctgattgggatttcacgtatg
attactgagtttgcttatggaaccgggagctgcatggagcccagcaactgtcccacgatt
atctgtggggtgcactacttgtactttgccattatcctcttcgccatttctttcatcacc
atcgtggtcatctccctcctcaccaaacccattccggatgtgcatctctaccgtctgtgt
tggagcctgcgcaacagcaaagaggagcgtattgacctggatgcggaagaggagaacatc
caagaaggccctaaggagaccattgaaatagaaacacaagttcctgagaagaaaaaagga
atcttcaggagagcctatgacctattttgtgggctagagcagcacggtgcacccaagatg
actgaggaagaggagaaagccatgaagatgaagatgacggacacctctgagaagcctttg
tggaggacagtgttgaacgtcaatggcatcatcctggtgaccgtggctgtcttttgccat
gcatattttgcctga

DBGET integrated database retrieval system