KEGG   Homo sapiens (human): 65266Help
Entry
65266             CDS       T01001                                 

Gene name
WNK4, PHA2B, PRKWNK4
Definition
WNK lysine deficient protein kinase 4 (EC:2.7.11.1)
Orthology
K08867  
WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Disease
H00243  
Hyperkalemic distal renal tubular acidosis (RTA type 4)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q21-q22
AA seq 1243 aa AA seqDB search
MLASPATETTVLMSQTEADLALRPPPPLGTAGQPRLGPPPRRARRFSGKAEPRPRSSRLS
RRSSVDLGLLSSWSLPASPAPDPPDPPDSAGPGPARSPPPSSKEPPEGTWTEGAPVKAAE
DSARPELPDSAVGPGSREPLRVPEAVALERRREQEEKEDMETQAVATSPDGRYLKFDIEI
GRGSFKTVYRGLDTDTTVEVAWCELQTRKLSRAERQRFSEEVEMLKGLQHPNIVRFYDSW
KSVLRGQVCIVLVTELMTSGTLKTYLRRFREMKPRVLQRWSRQILRGLHFLHSRVPPILH
RDLKCDNVFITGPTGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDEAVDVYA
FGMCMLEMATSEYPYSECQNAAQIYRKVTSGRKPNSFHKVKIPEVKEIIEGCIRTDKNER
FTIQDLLAHAFFREERGVHVELAEEDDGEKPGLKLWLRMEDARRGGRPRDNQAIEFLFQL
GRDAAEEVAQEMVALGLVCEADYQPVARAVRERVAAIQRKREKLRKARELEALPPEPGPP
PATVPMAPGPPSVFPPEPEEPEADQHQPFLFRHASYSSTTSDCETDGYLSSSGFLDASDP
ALQPPGGVPSSLAESHLCLPSAFALSIPRSGPGSDFSPGDSYASDAASGLSDVGEGMGQM
RRPPGRNLRRRPRSRLRVTSVSDQNDRVVECQLQTHNSKMVTFRFDLDGDSPEEIAAAMV
YNEFILPSERDGFLRRIREIIQRVETLLKRDTGPMEAAEDTLSPQEEPAPLPALPVPLPD
PSNEELQSSTSLEHRSWTAFSTSSSSPGTPLSPGNPFSPGTPISPGPIFPITSPPCHPSP
SPFSPISSQVSSNPSPHPTSSPLPFSSSTPEFPVPLSQCPWSSLPTTSPPTFSPTCSQVT
LSSPFFPPCPSTSSFPSTTAAPLLSLASAFSLAVMTVAQSLLSPSPGLLSQSPPAPPSPL
PSLPLPPPVAPGGQESPSPHTAEVESEASPPPARPLPGEARLAPISEEGKPQLVGRFQVT
SSKEPAEPLPLQPTSPTLSGSPKPSTPQLTSESSDTEDSAGGGPETREALAESDRAAEGL
GAGVEEEGDDGKEPQVGGSPQPLSHPSPVWMNYSYSSLCLSSEESESSGEDEEFWAELQS
LRQKHLSEVETLQTLQKKEIEDLYSRLGKQPPPGIVAPAAMLSSRQRRLSKGSFPTSRRN
SLQRSEPPGPGIMRRNSLSGSSTGSQEQRASKGVTFAGDVGRM
NT seq 3732 nt NT seq  +upstreamnt  +downstreamnt
atgttggcatccccggccacggagaccaccgtcctcatgtcccagactgaggccgacctg
gccctgcggcccccgcctcctcttggcaccgcggggcagccccgcctcgggccccctcct
cgccgagcgcgccgcttctccgggaaggctgagccccggccgcgctcttctcgtctcagc
cgccgtagctcagtcgacttggggctgctgagctcttggtccctgccagcctcacccgct
ccggacccccccgatcctccggactccgctggtcctggccccgcgaggagcccaccgcct
agctccaaagaaccccccgagggcacgtggaccgagggagcccctgtgaaggctgcggaa
gactccgcgcgtcccgagctcccggactctgcagtgggcccggggtccagggagccgcta
agggtccctgaagctgtggccctagagcggcggcgggagcaggaagaaaaggaggacatg
gagacccaggctgtggcaacgtcccccgatggccgatacctcaagtttgacatcgagatt
ggacgtggctccttcaagacggtgtatcgagggctagacaccgacaccacagtggaggtg
gcctggtgtgagctgcagactcggaaactgtctagagctgagcggcagcgcttctcagag
gaggtggagatgctcaaggggctgcagcaccccaacatcgtccgcttctatgattcgtgg
aagtcggtgctgaggggccaggtttgcatcgtgctggtcaccgaactcatgacctcgggc
acgctcaagacgtacctgaggcggttccgggagatgaagccgcgggtccttcagcgctgg
agccgccaaatcctgcggggacttcatttcctacactcccgggttcctcccatcctgcac
cgggatctcaagtgcgacaatgtctttatcacgggacctactggctctgtcaaaatcggg
gacctgggcctggccacgctcaagcgcgcctcctttgccaagagtgtcatcgggaccccg
gaattcatggcccccgagatgtacgaggaaaagtacgatgaggccgtggacgtgtacgcg
ttcggcatgtgcatgctggagatggccacctctgagtacccgtactccgagtgccagaat
gccgcgcaaatctaccgcaaggtcacttcgggcagaaagccgaacagcttccacaaggtg
aagatacccgaggtgaaggagatcattgaaggctgcatccgcacggataagaacgagagg
ttcaccatccaggacctcctggcccacgccttcttccgcgaggagcgcggtgtgcacgtg
gaactagcggaggaggacgacggcgagaagccgggcctcaagctctggctgcgcatggag
gacgcgcggcgcggggggcgcccacgggacaaccaggccatcgagttcctgttccagctg
ggccgggacgcggccgaggaggtggcacaggagatggtggctctgggcttggtctgtgaa
gccgattaccagccagtggcccgtgcagtacgtgaacgggttgctgccatccagcgaaag
cgtgagaagctgcgtaaagcaagggaattggaggcactcccaccagagccaggacctcca
ccagcaactgtgcccatggcccccggtccccccagtgtcttcccccctgagcctgaggag
ccagaggcagaccagcaccagcccttccttttccgccacgccagctactcatctaccact
tcggattgcgagactgatggctacctcagctcctccggcttcctggatgcctcagaccct
gcccttcagccccctgggggggtgccatccagcctggctgagtcccatctctgcctgccc
tcggcttttgccctatccattccacgttctggccctggaagtgacttttcccccggggac
agctatgcctcagatgcagcttcaggccttagcgatgtgggagaagggatgggacaaatg
aggagacccccagggaggaatctccggcgcagaccccgatcccggctgcgggtcactagt
gtctcagaccagaatgacagagtggttgagtgccagctacagacccataacagcaagatg
gtgaccttccgatttgatctggatggggacagcccggaagagattgcagctgccatggta
tataacgagttcattctgccttcggagcgagatggatttctcagacggattcgggagatt
atccagcgagtggagaccctgttgaagagagacactggccccatggaggctgctgaagac
accctaagcccccaggaggagccagcaccattacctgccctgcccgtccccctcccagac
ccatccaatgaagagctccagagcagcacctccctggagcacaggagctggacagccttc
tccacctcctcatcttctcctggaactcctttgtctcctggaaacccattttcccctgga
acccccatttccccaggtcccatcttccccatcacttctcccccatgtcatcccagcccc
tccccattctcccccatttcttcccaggtctcctcaaatccctctccacaccccaccagc
tctccacttccattctcctccagcacacccgagtttccggtcccactctctcagtgtccc
tggagttctctccccacgacttctccacctacgttctctcccacttgttctcaggtcact
cttagttcccctttctttcctccgtgcccctccacttcttccttcccctccaccacagca
gcccctctcctttctctggctagtgccttctcactggctgtgatgactgtggcccagtcc
ctgctgtccccctcacctgggctcctttcccagtctcctccagcccctcctagtcccctc
cctagcctgccccttccccctcccgttgctcctggtggccaggaaagcccttcaccccac
acagctgaggtggagagtgaggcctcaccacctcctgctcggcccctcccaggggaagcc
aggctggcgcccatctctgaagagggaaagccgcagcttgttgggcgtttccaagtgact
tcatccaaggaaccggctgagcctcttcccttgcagccaacatcccccactctctctggt
tctccaaaaccttcaacccctcagctcacttcagagagctcagatacagaggacagtgct
ggaggcgggccagagaccagggaagctctggctgagagcgaccgtgcagctgagggtctg
ggggctggagttgaggaggaaggagatgatgggaaggaaccccaagttgggggcagcccc
caacccctgagccatcccagcccagtgtggatgaactactcctacagcagcctgtgtttg
agcagcgaggagtcagaaagcagtggggaagatgaggagttctgggctgagctgcagagt
cttcggcagaagcacttgtcagaggtggaaacactacagacactacagaaaaaagaaatt
gaagatttgtacagccggctggggaagcagcccccaccgggtattgtggccccagctgct
atgctgtccagccgccagcgccgcctctccaagggcagcttccccacctcccgccgcaac
agcctacagcgctctgagcccccaggccctggcatcatgcgaaggaactctctgagtggc
agcagcaccggctcccaggagcagcgggcaagcaagggggtgacattcgccggggatgtt
ggcaggatgtga

DBGET integrated database retrieval system