KEGG   Homo sapiens (human): 6528Help
Entry
6528              CDS       T01001                                 

Gene name
SLC5A5, NIS, TDH1
Definition
solute carrier family 5 (sodium/iodide cotransporter), member 5
Orthology
K14385  
solute carrier family 5 (sodium/iodide cotransporter), member 5
Organism
hsa  Homo sapiens (human)
Pathway
Thyroid hormone synthesis
Disease
H00251  
Thyroid dyshormonogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    6528 (SLC5A5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.11
AA seq 643 aa AA seqDB search
MEAVETGERPTFGAWDYGVFALMLLVSTGIGLWVGLARGGQRSAEDFFTGGRRLAALPVG
LSLSASFMSAVQVLGVPSEAYRYGLKFLWMCLGQLLNSVLTALLFMPVFYRLGLTSTYEY
LEMRFSRAVRLCGTLQYIVATMLYTGIVIYAPALILNQVTGLDIWASLLSTGIICTFYTA
VGGMKAVVWTDVFQVVVMLSGFWVVLARGVMLVGGPRQVLTLAQNHSRINLMDFNPDPRS
RYTFWTFVVGGTLVWLSMYGVNQAQVQRYVACRTEKQAKLALLINQVGLFLIVSSAACCG
IVMFVFYTDCDPLLLGRISAPDQYMPLLVLDIFEDLPGVPGLFLACAYSGTLSTASTSIN
AMAAVTVEDLIKPRLRSLAPRKLVIISKGLSLIYGSACLTVAALSSLLGGGVLQGSFTVM
GVISGPLLGAFILGMFLPACNTPGVLAGLGAGLALSLWVALGATLYPPSEQTMRVLPSSA
ARCVALSVNASGLLDPALLPANDSSRAPSSGMDASRPALADSFYAISYLYYGALGTLTTV
LCGALISCLTGPTKRSTLAPGLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKK
PPGFLPTNEDRLFFLGQKELEGAGSWTPCVGHDGGRDQQETNL
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgtggagaccggggaacggcccaccttcggagcctgggactacggggtcttt
gccctcatgctcctggtgtccactggcatcgggctgtgggtcgggctggctcggggcggg
cagcgcagcgctgaggacttcttcaccgggggccggcgcctggcggccctgcccgtgggc
ctgtcgctgtctgccagcttcatgtcggccgtgcaggtgctgggcgtgccgtcggaggcc
tatcgctatggcctcaagttcctctggatgtgcctgggccagcttctgaactcggtcctc
accgccctgctcttcatgcccgtcttctaccgcctgggcctcaccagcacctacgagtac
ctggagatgcgcttcagccgcgcagtgcggctctgcgggactttgcagtacattgtagcc
acgatgctgtacaccggcatcgtaatctacgcaccggccctcatcctgaaccaagtgacc
gggctggacatctgggcgtcgctcctgtccaccggaattatctgcaccttctacacggct
gtgggcggcatgaaggctgtggtctggactgatgtgttccaggtcgtggtgatgctaagt
ggcttctgggttgtcctggcacgcggtgtcatgcttgtgggcgggccccgccaggtgctc
acgctggcccagaaccactcccggatcaacctcatggactttaaccctgacccgaggagc
cgctatacattctggacttttgtggtgggtggcacgttggtgtggctctccatgtatggc
gtgaaccaggcgcaggtgcagcgctacgtggcttgccgcacagagaagcaggccaagctg
gccctgctcatcaaccaggtcggcctgttcctgatcgtgtccagcgctgcctgctgtggc
atcgtcatgtttgtgttctacactgactgcgaccctctcctcctggggcgcatctctgcc
ccagaccagtacatgcctctgctggtgctggacatcttcgaagatctgcctggagtcccc
gggcttttcctggcctgtgcttacagtggcaccctcagcacagcatccaccagcatcaat
gctatggctgcagtcactgtagaagacctcatcaaacctcggctgcggagcctggcaccc
aggaaactcgtgattatctccaaggggctctcactcatctacggatcggcctgtctcacc
gtggcagccctgtcctcactgctcggaggaggtgtccttcagggctccttcaccgtcatg
ggagtcatcagcggccccctgctgggagccttcatcttgggaatgttcctgccggcctgc
aacacaccgggcgtcctcgcgggactaggcgcgggcttggcgctgtcgctgtgggtggcc
ttgggcgccacgctgtacccacccagcgagcagaccatgagggtcctgccatcgtcggct
gcccgctgcgtggctctctcagtcaacgcctctggcctcctggacccggctctcctccct
gctaacgactccagcagggcccccagctcaggaatggacgccagccgacccgccttagct
gacagcttctatgccatctcctatctctattacggtgccctgggcacgctgaccactgtg
ctgtgcggagccctcatcagctgcctgacaggccccaccaagcgcagcaccctggccccg
ggattgttgtggtgggacctcgcacggcagacagcatcagtggcccccaaggaagaagtg
gccatcctggatgacaacttggtcaagggtcctgaagaactccccactggaaacaagaag
ccccctggcttcctgcccaccaatgaggatcgtctgtttttcttggggcagaaggagctg
gagggggctggctcttggaccccctgtgttggacatgatggtggtcgagaccagcaggag
acaaacctctga

DBGET integrated database retrieval system