KEGG   Homo sapiens (human): 6575Help
Entry
6575              CDS       T01001                                 

Gene name
SLC20A2, GLVR-2, GLVR2, IBGC1, IBGC3, MLVAR, PIT-2, PIT2, RAM1
Definition
solute carrier family 20 (phosphate transporter), member 2
Orthology
K14640  
solute carrier family 20 (sodium-dependent phosphate transporter)
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8p11.21
AA seq 652 aa AA seqDB search
MAMDEYLWMVILGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETTGSV
LLGAKVGETIRKGIIDVNLYNETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVG
STIGFSLVAIGTKGVQWMELVKIVASWFISPLLSGFMSGLLFVLIRIFILKKEDPVPNGL
RALPVFYAATIAINVFSIMYTGAPVLGLVLPMWAIALISFGVALLFAFFVWLFVCPWMRR
KITGKLQKEGALSRVSDESLSKVQEAESPVFKELPGAKANDDSTIPLTGAAGETLGTSEG
TSAGSHPRAAYGRALSMTHGSVKSPISNGTFGFDGHTRSDGHVYHTVHKDSGLYKDLLHK
IHIDRGPEEKPAQESNYRLLRRNNSYTCYTAAICGLPVHATFRAADSSAPEDSEKLVGDT
VSYSKKRLRYDSYSSYCNAVAEAEIEAEEGGVEMKLASELADPDQPREDPAEEEKEEKDA
PEVHLLFHFLQVLTACFGSFAHGGNDVSNAIGPLVALWLIYKQGGVTQEAATPVWLLFYG
GVGICTGLWVWGRRVIQTMGKDLTPITPSSGFTIELASAFTVVIASNIGLPVSTTHCKVG
SVVAVGWIRSRKAVDWRLFRNIFVAWFVTVPVAGLFSAAVMALLMYGILPYV
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atggccatggatgagtatttgtggatggtcattttgggtttcatcatagctttcatcttg
gccttttctgttggtgcaaacgatgttgccaactcctttggtacagccgtgggctctggt
gtggtgaccttgaggcaggcatgcattttagcttcaatatttgaaaccaccggctccgtg
ttactaggcgccaaagtaggagaaaccattcgcaaaggtatcattgacgtgaacctgtac
aacgagacggtggagactctcatggctggggaagttagtgccatggttggttccgctgtg
tggcagctgattgcttccttcctgaggcttccaatctcaggaacgcactgcattgtgggt
tctactataggattctcactggtcgcaatcggtaccaaaggtgtgcagtggatggagctt
gtcaagattgttgcttcttggtttatatctccactgttgtctggtttcatgtctggcctg
ctgtttgtactcatcagaattttcatcttaaaaaaggaagaccctgttcccaatggcctc
cgggcactcccagtattctatgctgctaccatagcaatcaatgtcttttccatcatgtac
acaggagcaccagtgctcggccttgttctccccatgtgggccatagccctcatttccttt
ggtgtcgccctcctgttcgctttttttgtgtggctcttcgtgtgtccgtggatgcggagg
aaaataacaggcaaattacaaaaagaaggtgctttatcacgagtatctgacgaaagcctc
agtaaggttcaggaagcagagtccccagtatttaaagagctaccaggtgccaaggctaat
gatgacagcaccatcccgctcacgggagcagcaggggagacactggggacctcggaaggc
acttctgcgggcagccaccctcgggctgcatacggaagagcactgtccatgacccatggc
tctgtgaaatcgcccatctccaacggcaccttcggcttcgacggccacaccaggagcgac
ggtcatgtgtaccacaccgtgcacaaagactcggggctctacaaagatctgctgcacaaa
atccacatcgacaggggccccgaggagaagccagcccaggaaagcaactaccggctgctg
cgccgaaacaacagttacacctgctacaccgcagccatttgtgggctgccagtgcacgcc
acctttcgagctgcggactcatcggccccagaggacagtgagaagctggtgggcgacacc
gtgtcctactccaagaagaggctgcgctacgacagctactcgagctactgtaacgcggtg
gcagaggcggagatcgaggcggaggagggcggcgtggagatgaagctggcgtcggagctg
gccgaccctgaccagccgcgagaggaccctgcagaggaggagaaggaggagaaggacgca
cccgaggttcacctcctgttccatttcctgcaggtcctcaccgcctgtttcgggtccttt
gctcacggcggcaatgacgtgagtaatgccatcggtcccctggtagccttgtggctgatt
tacaaacaaggcggggtaacgcaagaagcagctacacccgtctggctgctgttttatgga
ggagttggaatctgcacaggcctctgggtctgggggagaagagtgatccagaccatgggg
aaggacctcactcccatcacgccgtccagcggcttcacgatcgagctggcctcagccttc
acagtggtgatcgcctccaacatcgggcttccagtcagcaccacgcactgtaaggtgggc
tcggtggtggccgtgggctggatccgctcccgcaaggctgtggactggcgcctctttcgg
aacatcttcgtggcctggttcgtgaccgtccctgtggctgggctgttcagcgctgctgtc
atggctcttctcatgtatgggatccttccatatgtgtga

DBGET integrated database retrieval system