KEGG   Homo sapiens (human): 6584Help
Entry
6584              CDS       T01001                                 

Gene name
SLC22A5, CDSP, OCTN2
Definition
(RefSeq) solute carrier family 22 (organic cation/carnitine transporter), member 5
  KO
K08202  
MFS transporter, OCT family, solute carrier family 22 (organic cation transporter), member 4/5
Organism
hsa  Homo sapiens (human)
Pathway
Choline metabolism in cancer
Disease
H00286  
Crohn's disease
H00525  
Disorders of fatty-acid oxidation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    6584 (SLC22A5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q23.3
AA seq 581 aa AA seqDB search
MRDYDEVTAFLGEWGPFQRLIFFLLSASIIPNGFTGLSSVFLIATPEHRCRVPDAANLSS
AWRNHTVPLRLRDGREVPHSCRRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFS
QDVYLSTIVTEQDSGAYNAMKNRMGKKPALCLPAQWNLVCEDDWKAPLTISLFFVGVLLG
SFISGQLSDRFGRKNVLFVTMGMQTGFSFLQIFSKNFEMFVVLFVLVGMGQISNYVAAFV
LGTEILGKSVRIIFSTLGVCIFYAFGYMVLPLFAYFIRDWRMLLVALTMPGVLCVALWWF
IPESPRWLISQGRFEEAEVIIRKAAKANGIVVPSTIFDPSELQDLSSKKQQSHNILDLLR
TWNIRMVTIMSIMLWMTISVGYFGLSLDTPNLHGDIFVNCFLSAMVEVPAYVLAWLLLQY
LPRRYSMATALFLGGSVLLFMQLVPPDLYYLATVLVMVGKFGVTAAFSMVYVYTAELYPT
VVRNMGVGVSSTASRLGSILSPYFVYLGAYDRFLPYILMGSLTILTAILTLFLPESFGTP
LPDTIDQMLRVKGMKHRKTPSHTRMLKDGQERPTILKSTAF
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgcgggactacgacgaggtgaccgccttcctgggcgagtgggggcccttccagcgcctc
atcttcttcctgctcagcgccagcatcatccccaatggcttcaccggcctgtcctccgtg
ttcctgatagcgaccccggagcaccgctgccgggtgccggacgccgcgaacctgagcagc
gcctggcgcaaccacactgtcccactgcggctgcgggacggccgcgaggtgccccacagc
tgccgccgctaccggctcgccaccatcgccaacttctcggcgcttgggctggagccgggg
cgcgacgtggacctggggcagctggagcaggagagctgtctggatggctgggagttcagt
caggacgtctacctgtccaccattgtgaccgagcaagacagtggggcctacaatgctatg
aaaaacaggatgggaaagaagcctgctctctgccttcctgcccagtggaacctggtgtgt
gaggacgactggaaggccccactcacaatctccttgttcttcgtgggtgtgctgttgggc
tccttcatttcagggcagctgtcagacaggtttggccggaagaatgtgctgttcgtgacc
atgggcatgcagacaggcttcagcttcctgcagatcttctcgaagaattttgagatgttt
gtcgtgctgtttgtccttgtaggcatgggccagatctccaactatgtggcagcatttgtc
ctggggacagaaattcttggcaagtcagttcgtataatattctctacgttaggagtgtgc
atattttatgcatttggctacatggtgctgccactgtttgcttacttcatccgagactgg
cggatgctgctggtggcgctgacgatgccgggggtgctatgcgtggcactctggtggttc
atccctgagtccccccgatggctcatctctcagggacgatttgaagaggcagaggtgatc
atccgcaaggctgccaaagccaatgggattgttgtgccttccactatctttgacccgagt
gagttacaagacctaagttccaagaagcagcagtcccacaacattctggatctgcttcga
acctggaatatccggatggtcaccatcatgtccataatgctgtggatgaccatatcagtg
ggctattttgggctttcgcttgatactcctaacttgcatggggacatctttgtgaactgc
ttcctttcagcgatggttgaagtcccagcatatgtgttggcctggctgctgctgcaatat
ttgccccggcgctattccatggccactgccctcttcctgggtggcagtgtccttctcttc
atgcagctggtacccccagacttgtattatttggctacagtcctggtgatggtgggcaag
tttggagtcacggctgccttttccatggtctacgtgtacacagccgagctgtatcccaca
gtggtgagaaacatgggtgtgggagtcagctccacagcatcccgcctgggcagcatcctg
tctccctacttcgtttaccttggtgcctacgaccgcttcctgccctacattctcatggga
agtctgaccatcctgacagccatcctcaccttgtttctcccagagagcttcggtacccca
ctcccagacaccattgaccagatgctaagagtcaaaggaatgaaacacagaaaaactcca
agtcacacaaggatgttaaaagatggtcaagaaaggcccacaatccttaaaagcacagcc
ttctaa

DBGET integrated database retrieval system