KEGG   Homo sapiens (human): 6584Help
Entry
6584              CDS       T01001                                 

Gene name
SLC22A5, CDSP, OCTN2, OCTN2VT
Definition
solute carrier family 22 (organic cation/carnitine transporter), member 5
Orthology
K08202  
MFS transporter, OCT family, solute carrier family 22 (organic cation transporter), member 4/5
Organism
hsa  Homo sapiens (human)
Disease
H00286  
Crohn's disease
H00525  
Disorders of fatty-acid oxidation
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q23.3
AA seq 557 aa AA seqDB search
MRDYDEVTAFLGEWGPFQRLIFFLLSASIIPNGFTGLSSVFLIATPEHRCRVPDAANLSS
AWRNHTVPLRLRDGREVPHSCRRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFS
QDVYLSTIVTEWNLVCEDDWKAPLTISLFFVGVLLGSFISGQLSDRFGRKNVLFVTMGMQ
TGFSFLQIFSKNFEMFVVLFVLVGMGQISNYVAAFVLGTEILGKSVRIIFSTLGVCIFYA
FGYMVLPLFAYFIRDWRMLLVALTMPGVLCVALWWFIPESPRWLISQGRFEEAEVIIRKA
AKANGIVVPSTIFDPSELQDLSSKKQQSHNILDLLRTWNIRMVTIMSIMLWMTISVGYFG
LSLDTPNLHGDIFVNCFLSAMVEVPAYVLAWLLLQYLPRRYSMATALFLGGSVLLFMQLV
PPDLYYLATVLVMVGKFGVTAAFSMVYVYTAELYPTVVRNMGVGVSSTASRLGSILSPYF
VYLGAYDRFLPYILMGSLTILTAILTLFLPESFGTPLPDTIDQMLRVKGMKHRKTPSHTR
MLKDGQERPTILKSTAF
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgcgggactacgacgaggtgaccgccttcctgggcgagtgggggcccttccagcgcctc
atcttcttcctgctcagcgccagcatcatccccaatggcttcaccggcctgtcctccgtg
ttcctgatagcgaccccggagcaccgctgccgggtgccggacgccgcgaacctgagcagc
gcctggcgcaaccacactgtcccactgcggctgcgggacggccgcgaggtgccccacagc
tgccgccgctaccggctcgccaccatcgccaacttctcggcgcttgggctggagccgggg
cgcgacgtggacctggggcagctggagcaggagagctgtctggatggctgggagttcagt
caggacgtctacctgtccaccattgtgaccgagtggaacctggtgtgtgaggacgactgg
aaggccccactcacaatctccttgttcttcgtgggtgtgctgttgggctccttcatttca
gggcagctgtcagacaggtttggccggaagaatgtgctgttcgtgaccatgggcatgcag
acaggcttcagcttcctgcagatcttctcgaagaattttgagatgtttgtcgtgctgttt
gtccttgtaggcatgggccagatctccaactatgtggcagcatttgtcctggggacagaa
attcttggcaagtcagttcgtataatattctctacgttaggagtgtgcatattttatgca
tttggctacatggtgctgccactgtttgcttacttcatccgagactggcggatgctgctg
gtggcgctgacgatgccgggggtgctatgcgtggcactctggtggttcatccctgagtcc
ccccgatggctcatctctcagggacgatttgaagaggcagaggtgatcatccgcaaggct
gccaaagccaatgggattgttgtgccttccactatctttgacccgagtgagttacaagac
ctaagttccaagaagcagcagtcccacaacattctggatctgcttcgaacctggaatatc
cggatggtcaccatcatgtccataatgctgtggatgaccatatcagtgggctattttggg
ctttcgcttgatactcctaacttgcatggggacatctttgtgaactgcttcctttcagcg
atggttgaagtcccagcatatgtgttggcctggctgctgctgcaatatttgccccggcgc
tattccatggccactgccctcttcctgggtggcagtgtccttctcttcatgcagctggta
cccccagacttgtattatttggctacagtcctggtgatggtgggcaagtttggagtcacg
gctgccttttccatggtctacgtgtacacagccgagctgtatcccacagtggtgagaaac
atgggtgtgggagtcagctccacagcatcccgcctgggcagcatcctgtctccctacttc
gtttaccttggtgcctacgaccgcttcctgccctacattctcatgggaagtctgaccatc
ctgacagccatcctcaccttgtttctcccagagagcttcggtaccccactcccagacacc
attgaccagatgctaagagtcaaaggaatgaaacacagaaaaactccaagtcacacaagg
atgttaaaagatggtcaagaaaggcccacaatccttaaaagcacagccttctaa

DBGET integrated database retrieval system