KEGG   Homo sapiens (human): 6591Help
Entry
6591              CDS       T01001                                 

Gene name
SNAI2, SLUG, SLUGH1, SNAIL2, WS2D
Definition
snail family zinc finger 2
Orthology
K05706  
snail 2
Organism
hsa  Homo sapiens (human)
Pathway
Hippo signaling pathway
Adherens junction
Disease
H00170  
Piebaldism
H00759  
Waardenburg syndrome (WS)
Class
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:hsa04390]
Cellular Processes; Cell communication; Adherens junction [PATH:hsa04520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q11
AA seq 268 aa AA seqDB search
MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWT
TAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDP
HAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRT
HTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKK
YQCKNCSKTFSRMSLLHKHEESGCCVAH
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgctccttcctggtcaagaagcatttcaacgcctccaaaaagccaaactacagc
gaactggacacacatacagtgattatttccccgtatctctatgagagttactccatgcct
gtcataccacaaccagagatcctcagctcaggagcatacagccccatcactgtgtggact
accgctgctccattccacgcccagctacccaatggcctctctcctctttccggatactcc
tcatctttggggcgagtgagtccccctcctccatctgacacctcctccaaggaccacagt
ggctcagaaagccccattagtgatgaagaggaaagactacagtccaagctttcagacccc
catgccattgaagctgaaaagtttcagtgcaatttatgcaataagacctattcaactttt
tctgggctggccaaacataagcagctgcactgcgatgcccagtctagaaaatctttcagc
tgtaaatactgtgacaaggaatatgtgagcctgggcgccctgaagatgcatattcggacc
cacacattaccttgtgtttgcaagatctgcggcaaggcgttttccagaccctggttgctt
caaggacacattagaactcacacgggggagaagcctttttcttgccctcactgcaacaga
gcatttgcagacaggtcaaatctgagggctcatctgcagacccattctgatgtaaagaaa
taccagtgcaaaaactgctccaaaaccttctccagaatgtctctcctgcacaaacatgag
gaatctggctgctgtgtagcacactga

DBGET integrated database retrieval system