KEGG   Homo sapiens (human): 6597Help
Entry
6597              CDS       T01001                                 

Gene name
SMARCA4, BAF190, BAF190A, BRG1, CSS4, MRD16, RTPS2, SNF2, SNF2L4, SNF2LB, SWI2, hSNF2b
Definition
(RefSeq) SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
  KO
K11647  
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 2/4 [EC:3.6.4.-]
Organism
hsa  Homo sapiens (human)
Disease
H00773  
Autosomal dominant mental retardation
H01134  
Rhabdoid predisposition syndrome (RPS)
H01403  
Coffin-Siris syndrome
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     6597 (SMARCA4)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     6597 (SMARCA4)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Chromatin remodeling factors
   BAF complex
    6597 (SMARCA4)
   PBAF complex
    6597 (SMARCA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.2
AA seq 1647 aa AA seqDB search
MSTPDPPLGGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPIPTQG
PGGYPQDNMHQMHKPMESMHEKGMSDDPRYNQMKGMGMRSGGHAGMGPPPSPMDQHSQGY
PSPLGGSEHASSPVPASGPSSGPQMSSGPGGAPLDGADPQALGQQNRGPTPFNQNQLHQL
RAQIMAYKMLARGQPLPDHLQMAVQGKRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGP
GPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTSTPQ
KLIPPQPTGRPSPAPPAVPPAASPVMPPQTQSPGQPAQPAPMVPLHQKQSRITPIQKPRG
LDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEV
VVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSIL
QHAKDFKEYHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRK
LIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIG
PDGEPLDETSQMSDLPVKVIHVESGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEES
GSEEEEEEEEEEQPQAAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGV
SQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADE
MGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAA
RRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTH
YVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEE
TILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTD
GSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASG
KFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLK
TFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVR
VLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESR
HCSTGSGSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMD
LDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYS
DSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQ
KKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYEL
IRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSV
RQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGS
RAKPVVSDDDSEEEQEEDRSGSGSEED
NT seq 4944 nt NT seq  +upstreamnt  +downstreamnt
atgtccactccagacccacccctgggcggaactcctcggccaggtccttccccgggccct
ggcccttcccctggagccatgctgggccctagcccgggtccctcgccgggctccgcccac
agcatgatggggcccagcccagggccgccctcagcaggacaccccatccccacccagggg
cctggagggtaccctcaggacaacatgcaccagatgcacaagcccatggagtccatgcat
gagaagggcatgtcggacgacccgcgctacaaccagatgaaaggaatggggatgcggtca
gggggccatgctgggatggggcccccgcccagccccatggaccagcactcccaaggttac
ccctcgcccctgggtggctctgagcatgcctctagtccagttccagccagtggcccgtct
tcggggccccagatgtcttccgggccaggaggtgccccgctggatggtgctgacccccag
gccttggggcagcagaaccggggcccaaccccatttaaccagaaccagctgcaccagctc
agagctcagatcatggcctacaagatgctggccagggggcagcccctccccgaccacctg
cagatggcggtgcagggcaagcggccgatgcccgggatgcagcagcagatgccaacgcta
cctccaccctcggtgtccgcaacaggacccggccctggccctggccctggccccggcccg
ggtcccggcccggcacctccaaattacagcaggcctcatggtatgggagggcccaacatg
cctcccccaggaccctcgggcgtgccccccgggatgccaggccagcctcctggagggcct
cccaagccctggcctgaaggacccatggcgaatgctgctgcccccacgagcacccctcag
aagctgattcccccgcagccaacgggccgcccttcccccgcgccccctgccgtcccaccc
gccgcctcgcccgtgatgccaccgcagacccagtcccccgggcagccggcccagcccgcg
cccatggtgccactgcaccagaagcagagccgcatcacccccatccagaagccgcggggc
ctcgaccctgtggagatcctgcaggagcgcgagtacaggctgcaggctcgcatcgcacac
cgaattcaggaacttgaaaaccttcccgggtccctggccggggatttgcgaaccaaagcg
accattgagctcaaggccctcaggctgctgaacttccagaggcagctgcgccaggaggtg
gtggtgtgcatgcggagggacacagcgctggagacagccctcaatgctaaggcctacaag
cgcagcaagcgccagtccctgcgcgaggcccgcatcactgagaagctggagaagcagcag
aagatcgagcaggagcgcaagcgccggcagaagcaccaggaatacctcaatagcattctc
cagcatgccaaggatttcaaggaatatcacagatccgtcacaggcaaaatccagaagctg
accaaggcagtggccacgtaccatgccaacacggagcgggagcagaagaaagagaacgag
cggatcgagaaggagcgcatgcggaggctcatggctgaagatgaggaggggtaccgcaag
ctcatcgaccagaagaaggacaagcgcctggcctacctcttgcagcagacagacgagtac
gtggctaacctcacggagctggtgcggcagcacaaggctgcccaggtcgccaaggagaaa
aagaagaaaaagaaaaagaagaaggcagaaaatgcagaaggacagacgcctgccattggg
ccggatggcgagcctctggacgagaccagccagatgagcgacctcccggtgaaggtgatc
cacgtggagagtgggaagatcctcacaggcacagatgcccccaaagccgggcagctggag
gcctggctcgagatgaacccggggtatgaagtagctccgaggtctgatagtgaagaaagt
ggctcagaagaagaggaagaggaggaggaggaagagcagccgcaggcagcacagcctccc
accctgcccgtggaggagaagaagaagattccagatccagacagcgatgacgtctctgag
gtggacgcgcggcacatcattgagaatgccaagcaagatgtcgatgatgaatatggcgtg
tcccaggcccttgcacgtggcctgcagtcctactatgccgtggcccatgctgtcactgag
agagtggacaagcagtcagcgcttatggtcaatggtgtcctcaaacagtaccagatcaaa
ggtttggagtggctggtgtccctgtacaacaacaacctgaacggcatcctggccgacgag
atgggcctggggaagaccatccagaccatcgcgctcatcacgtacctcatggagcacaaa
cgcatcaatgggcccttcctcatcatcgtgcctctctcaacgctgtccaactgggcgtac
gagtttgacaagtgggccccctccgtggtgaaggtgtcttacaagggatccccagcagca
agacgggcctttgtcccccagctccggagtgggaagttcaacgtcttgctgacgacgtac
gagtacatcatcaaagacaagcacatcctcgccaagatccgttggaagtacatgattgtg
gacgaaggtcaccgcatgaagaaccaccactgcaagctgacgcaggtgctcaacacgcac
tatgtggcaccccgccgcctgctgctgacgggcacaccgctgcagaacaagcttcccgag
ctctgggcgctgctcaacttcctgctgcccaccatcttcaagagctgcagcaccttcgag
cagtggtttaacgcaccctttgccatgaccggggaaaaggtggacctgaatgaggaggaa
accattctcatcatccggcgtctccacaaagtgctgcggcccttcttgctccgacgactc
aagaaggaagtcgaggcccagttgcccgaaaaggtggagtacgtcatcaagtgcgacatg
tctgcgctgcagcgagtgctctaccgccacatgcaggccaagggcgtgctgctgactgat
ggctccgagaaggacaagaagggcaaaggcggcaccaagaccctgatgaacaccatcatg
cagctgcggaagatctgcaaccacccctacatgttccagcacatcgaggagtccttttcc
gagcacttggggttcactggcggcattgtccaagggctggacctgtaccgagcctcgggt
aaatttgagcttcttgatagaattcttcccaaactccgagcaaccaaccacaaagtgctg
ctgttctgccaaatgacctccctcatgaccatcatggaagattactttgcgtatcgcggc
tttaaatacctcaggcttgatggaaccacgaaggcggaggaccggggcatgctgctgaaa
accttcaacgagcccggctctgagtacttcatcttcctgctcagcacccgggctgggggg
ctcggcctgaacctccagtcggcagacactgtgatcatttttgacagcgactggaatcct
caccaggacctgcaagcgcaggaccgagcccaccgcatcgggcagcagaacgaggtgcgt
gtgctccgcctctgcaccgtcaacagcgtggaggagaagatcctagctgcagccaagtac
aagctcaacgtggaccagaaggtgatccaggccggcatgttcgaccagaagtcctccagc
catgagcggcgcgccttcctgcaggccatcctggagcacgaggagcaggatgagagcaga
cactgcagcacgggcagcggcagtgccagcttcgcccacactgcccctccgccagcgggc
gtcaaccccgacttggaggagccacctctaaaggaggaagacgaggtgcccgacgacgag
accgtcaaccagatgatcgcccggcacgaggaggagtttgatctgttcatgcgcatggac
ctggaccgcaggcgcgaggaggcccgcaaccccaagcggaagccgcgcctcatggaggag
gacgagctcccctcgtggatcatcaaggacgacgcggaggtggagcggctgacctgtgag
gaggaggaggagaagatgttcggccgtggctcccgccaccgcaaggaggtggactacagc
gactcactgacggagaagcagtggctcaaggccatcgaggagggcacgctggaggagatc
gaagaggaggtccggcagaagaaatcatcacggaagcgcaagcgagacagcgacgccggc
tcctccaccccgaccaccagcacccgcagccgcgacaaggacgacgagagcaagaagcag
aagaagcgcgggcggccgcctgccgagaaactctcccctaacccacccaacctcaccaag
aagatgaagaagattgtggatgccgtgatcaagtacaaggacagcagcagtggacgtcag
ctcagcgaggtcttcatccagctgccctcgcgaaaggagctgcccgagtactacgagctc
atccgcaagcccgtggacttcaagaagataaaggagcgcattcgcaaccacaagtaccgc
agcctcaacgacctagagaaggacgtcatgctcctgtgccagaacgcacagaccttcaac
ctggagggctccctgatctatgaagactccatcgtcttgcagtcggtcttcaccagcgtg
cggcagaaaatcgagaaggaggatgacagtgaaggcgaggagagtgaggaggaggaagag
ggcgaggaggaaggctccgaatccgaatctcggtccgtcaaagtgaagatcaagcttggc
cggaaggagaaggcacaggaccggctgaagggcggccggcggcggccgagccgagggtcc
cgagccaagccggtcgtgagtgacgatgacagtgaggaggaacaagaggaggaccgctca
ggaagtggcagcgaagaagactga

DBGET integrated database retrieval system