KEGG   Homo sapiens (human): 6605Help
Entry
6605              CDS       T01001                                 

Gene name
SMARCE1, BAF57
Definition
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1
Orthology
K11651  
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E, member 1
Organism
hsa  Homo sapiens (human)
Disease
H01403  
Coffin-Siris syndrome
Brite
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     6605 (SMARCE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Vega: 
UniProt: 
Position
17q21.2
AA seq 411 aa AA seqDB search
MSKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSRVTASSGITIP
KPPKPPDKPLMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYE
AEKIEYNESMKAYHNSPAYLAYINAKSRAEAALEEESRQRQSRMEKGEPYMSIQPAEDPD
DYDDGFSMKHTATARFQRNHRLISEILSESVVPDVRSVVTTARMQVLKRQVQSLMVHQRK
LEAELLQIEERHQEKKRKFLESTDSFNNELKRLCGLKVEVDMEKIAAEIAQAEEQARKRQ
EEREKEAAEQAERSQSSIVPEEEQAANKGEEKKDDENIPMETEETHLEETTESQQNGEEG
TSTPEDKESGQEGVDSMAEEGTSDSNTGSESNSATVEEPPTDPIPEDEKKE
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaagaccatcttatgccccacctcccaccccagctcctgcaacacaaatgccc
agcacaccagggtttgtgggatacaatccatacagtcatctcgcctacaacaactacagg
ctgggagggaacccgggcaccaacagccgggtcacggcatcctctggtatcacgattcca
aaacccccaaagccaccagataagccgctgatgccctacatgaggtacagcagaaaggtc
tgggaccaagtaaaggcttccaaccctgacctaaagttgtgggagattggcaagattatt
ggtggcatgtggcgagatctcactgatgaagaaaaacaagaatatttaaacgaatacgaa
gcagaaaagatagagtacaatgaatctatgaaggcctatcataattcccccgcgtacctt
gcttacataaatgcaaaaagtcgtgcagaagctgctttagaggaagaaagtcgacagaga
caatctcgcatggagaaaggagaaccgtacatgagcattcagcctgctgaagatccagat
gattatgatgatggcttttcaatgaagcatacagccaccgcccgtttccagagaaaccac
cgcctcatcagtgaaattcttagtgagagtgtggtgccagacgttcggtcagttgtcaca
acagctagaatgcaggtcctcaaacggcaggtccagtccttaatggttcatcagcgaaaa
ctagaagctgaacttcttcaaatagaggaacgacaccaggagaagaagaggaaattcctg
gaaagcacagattcatttaacaatgaacttaaaaggttgtgcggtctgaaagtagaagtg
gatatggagaaaattgcagctgagattgcacaggcagaggaacaggcccgcaaaaggcag
gaggaaagggagaaggaggccgcagagcaagctgagcgcagtcagagcagcatcgttcct
gaggaagaacaagcagctaacaaaggcgaggagaagaaagacgacgagaacattccgatg
gagacagaggagacacaccttgaagaaacaacagagagccaacagaatggtgaagaaggc
acgtctactcctgaggacaaggagagtgggcaggagggggtcgacagtatggcagaggaa
ggaaccagtgatagtaacactggctcggagagcaacagtgcaacagtggaggagccacca
acagatcccataccagaagatgagaaaaaagaataa

DBGET integrated database retrieval system