KEGG   Homo sapiens (human): 6613Help
Entry
6613              CDS       T01001                                 

Gene name
SUMO2, HSMT3, SMT3B, SMT3H2, SUMO3, Smt3A
Definition
(RefSeq) small ubiquitin-like modifier 2
  KO
K12160  
small ubiquitin-related modifier
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    6613 (SUMO2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     6613 (SUMO2)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   6613 (SUMO2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    6613 (SUMO2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    6613 (SUMO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q25.1
AA seq 95 aa AA seqDB search
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRF
RFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgaaaagcccaaggaaggagtcaagactgagaacaacgatcatattaatttg
aaggtggcggggcaggatggttctgtggtgcagtttaagattaagaggcatacaccactt
agtaaactaatgaaagcctattgtgaacgacagggattgtcaatgaggcagatcagattc
cgatttgacgggcaaccaatcaatgaaacagacacacctgcacagttggaaatggaggat
gaagatacaattgatgtgttccaacagcagacgggaggtgtctactga

DBGET integrated database retrieval system