KEGG   Homo sapiens (human): 6614Help
Entry
6614              CDS       T01001                                 

Gene name
SIGLEC1, CD169, SIGLEC-1, SN, dJ1009E24.1
Definition
sialic acid binding Ig-like lectin 1, sialoadhesin
Orthology
K06548  
sialoadhesin
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Class
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:hsa04514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20p13
AA seq 1709 aa AA seqDB search
MGFLPKLLLLASFFPAGQASWGVSSPQDVQGVKGSCLLIPCIFSFPADVEVPDGITAIWY
YDYSGQRQVVSHSADPKLVEARFRGRTEFMGNPEHRVCNLLLKDLQPEDSGSYNFRFEIS
EVNRWSDVKGTLVTVTEEPRVPTIASPVELLEGTEVDFNCSTPYVCLQEQVRLQWQGQDP
ARSVTFNSQKFEPTGVGHLETLHMAMSWQDHGRILRCQLSVANHRAQSEIHLQVKYAPKG
VKILLSPSGRNILPGELVTLTCQVNSSYPAVSSIKWLKDGVRLQTKTGVLHLPQAAWSDA
GVYTCQAENGVGSLVSPPISLHIFMAEVQVSPAGPILENQTVTLVCNTPNEAPSDLRYSW
YKNHVLLEDAHSHTLRLHLATRADTGFYFCEVQNVHGSERSGPVSVVVNHPPLTPVLTAF
LETQAGLVGILHCSVVSEPLATLVLSHGGHILASTSGDSDHSPRFSGTSGPNSLRLEIRD
LEETDSGEYKCSATNSLGNATSTLDFHANAARLLISPAAEVVEGQAVTLSCRSGLSPTPD
ARFSWYLNGALLHEGPGSSLLLPAASSTDAGSYHCRARDGHSASGPSSPAVLTVLYPPRQ
PTFTTRLDLDAAGAGAGRRGLLLCRVDSDPPARLQLLHKDRVVATSLPSGGGCSTCGGCS
PRMKVTKAPNLLRVEIHNPLLEEEGLYLCEASNALGNASTSATFNGQATVLAIAPSHTLQ
EGTEANLTCNVSREAAGSPANFSWFRNGVLWAQGPLETVTLLPVARTDAALYACRILTEA
GAQLSTPVLLSVLYPPDRPKLSALLDMGQGHMALFICTVDSRPLALLALFHGEHLLATSL
GPQVPSHGRFQAKAEANSLKLEVRELGLGDSGSYRCEATNVLGSSNTSLFFQVRGAWVQV
SPSPELQEGQAVVLSCQVHTGVPEGTSYRWYRDGQPLQESTSATLRFAAITLTQAGAYHC
QAQAPGSATTSLAAPISLHVSYAPRHVTLTTLMDTGPGRLGLLLCRVDSDPPAQLRLLHG
DRLVASTLQGVGGPEGSSPRLHVAVAPNTLRLEIHGAMLEDEGVYICEASNTLGQASASA
DFDAQAVNVQVWPGATVREGQLVNLTCLVWTTHPAQLTYTWYQDGQQRLDAHSIPLPNVT
VRDATSYRCGVGPPGRAPRLSRPITLDVLYAPRNLRLTYLLESHGGQLALVLCTVDSRPP
AQLALSHAGRLLASSTAASVPNTLRLELRGPQPRDEGFYSCSARSPLGQANTSLELRLEG
VRVILAPEAAVPEGAPITVTCADPAAHAPTLYTWYHNGRWLQEGPAASLSFLVATRAHAG
AYSCQAQDAQGTRSSRPAALQVLYAPQDAVLSSFRDSRARSMAVIQCTVDSEPPAELALS
HDGKVLATSSGVHSLASGTGHVQVARNALRLQVQDVPAGDDTYVCTAQNLLGSISTIGRL
QVEGARVVAEPGLDVPEGAALNLSCRLLGGPGPVGNSTFAWFWNDRRLHAEPVPTLAFTH
VARAQAGMYHCLAELPTGAAASAPVMLRVLYPPKTPTMMVFVEPEGGLRGILDCRVDSEP
LASLTLHLGSRLVASSQPQGAPAEPHIHVLASPNALRVDIEALRPSDQGEYICSASNVLG
SASTSTYFGVRALHRLHQFQQLLWVLGLLVGLLLLLLGLGACYTWRRRRVCKQSMGENSV
EMAFQKETTQLIDPDAATCETSTCAPPLG
NT seq 5130 nt NT seq  +upstreamnt  +downstreamnt
atgggcttcttgcccaagcttctcctcctggcctcattcttcccagcaggccaggcctca
tggggcgtctccagtccccaggacgtgcagggtgtgaaggggtcttgcctgcttatcccc
tgcatcttcagcttccctgccgacgtggaggtgcccgacggcatcacggccatctggtac
tacgactactcgggccagcggcaggtggtgagccactcggcggaccccaagctggtggag
gcccgcttccgcggccgcaccgagttcatggggaaccccgagcacagggtgtgcaacctg
ctgctgaaggacctgcagcccgaggactctggttcctacaacttccgcttcgagatcagt
gaggtcaaccgctggtcagatgtgaaaggcaccttggtcacagtaacagaggagcccagg
gtgcccaccattgcctccccggtggagcttctcgagggcacagaggtggacttcaactgc
tccactccctacgtatgcctgcaggagcaggtcagactgcagtggcaaggccaggaccct
gctcgctctgtcaccttcaacagccagaagtttgagcccaccggcgtcggccacctggag
accctccacatggccatgtcctggcaggaccacggccggatcctgcgctgccagctctcc
gtggccaatcacagggctcagagcgagattcacctccaagtgaagtatgcccccaagggt
gtgaagatcctcctcagcccctcggggaggaacatccttccaggtgagctggtcacactc
acctgccaggtgaacagcagctaccctgcagtcagttccattaagtggctcaaggatggg
gtacgcctccaaaccaagactggtgtgctgcacctgccccaggcagcctggagcgatgct
ggcgtctacacctgccaagctgagaacggcgtgggctctttggtctcaccccccatcagc
ctccacatcttcatggctgaggtccaggtgagcccagcaggtcccatcctggagaaccag
acagtgacactagtctgcaacacacccaatgaggcacccagtgatctccgctacagctgg
tacaagaaccatgtcctgctggaggatgcccactcccataccctccggctgcacttggcc
actagggctgatactggcttctacttctgtgaggtgcagaacgtccatggcagcgagcgc
tcgggccctgtcagcgtggtagtcaaccacccgcctctcactccagtcctgacagccttc
ctggagacccaggcgggacttgtgggcatccttcactgctctgtggtcagtgagcccctg
gccacactggtgctgtcacatgggggtcatatcctggcctccacctccggggacagtgat
cacagcccacgcttcagtggtacctctggtcccaactccctgcgcctggagatccgagac
ctggaggaaactgacagtggggagtacaagtgctcagccaccaactcccttggaaatgca
acctccaccctggacttccatgccaatgccgcccgtctcctcatcagcccggcagccgag
gtggtggaaggacaggcagtgacactgagctgcagaagcggcctaagccccacacctgat
gcccgcttctcctggtacctgaatggagccctgcttcacgagggtcccggcagcagcctc
ctgctccccgcggcctccagcactgacgccggctcataccactgccgggcccgggacggc
cacagtgccagtggcccctcttcgccagctgttctcactgtgctctacccccctcgacaa
ccaacattcaccaccaggctggaccttgatgccgctggggccggggctggacggcgaggc
ctccttttgtgccgtgtggacagcgacccccccgccaggctgcagctgctccacaaggac
cgtgttgtggccacttccctgccatcagggggtggctgcagcacctgtgggggctgttcc
ccacgcatgaaggtcaccaaagcccccaacttgctgcgtgtggagattcacaaccctttg
ctggaagaggagggcttgtacctctgtgaggccagcaatgccctgggcaacgcctccacc
tcagccaccttcaatggccaggccactgtcctggccattgcaccatcacacacacttcag
gagggcacagaagccaacttgacttgcaacgtgagccgggaagctgctggcagccctgct
aacttctcctggttccgaaatggggtgctgtgggcccagggtcccctggagaccgtgaca
ctgctgcccgtggccagaactgatgctgccctttacgcctgccgcatcctgactgaggct
ggtgcccagctctccactcccgtgctcctgagtgtactctatcccccggaccgtccaaag
ctgtcagccctcctagacatgggccagggccacatggctctgttcatctgcactgtggac
agccgccccctggccttgctggccttgttccatggggagcacctcctggccaccagcctg
ggtccccaggtcccatcccatggtcggttccaggctaaagctgaggccaactccctgaag
ttagaggtccgagaactgggccttggggactctggcagctaccgctgtgaggccacaaat
gttcttggatcatccaacacctcactcttcttccaggtccgaggagcctgggtccaggtg
tcaccatcacctgagctccaagagggccaggctgtggtcctgagctgccaggtacacaca
ggagtcccagaggggacctcatatcgttggtatcgggatggccagcccctccaggagtcg
acctcggccacgctccgctttgcagccataactttgacacaagctggggcctatcattgc
caagcccaggccccaggctcagccaccacgagcctagctgcacccatcagcctccacgtg
tcctatgccccacgccacgtcacactcactaccctgatggacacaggccctggacgactg
ggcctcctcctgtgccgtgtggacagtgaccctccggcccagctgcggctgctccacggg
gatcgccttgtggcctccaccctacaaggtgtggggggacccgaaggcagctctcccagg
ctgcatgtggctgtggcccccaacacactgcgtctggagatccacggggctatgctggag
gatgagggtgtctatatctgtgaggcctccaacaccctgggccaggcctcggcctcagct
gacttcgacgctcaagctgtgaatgtgcaggtgtggcccggggctaccgtgcgggagggg
cagctggtgaacctgacctgccttgtgtggaccactcacccggcccagctcacctacaca
tggtaccaggatgggcagcagcgcctggatgcccactccatccccctgcccaacgtcaca
gtcagggatgccacctcctaccgctgcggtgtgggcccccctggtcgggcaccccgcctc
tccagacctatcaccttggacgtcctctacgcgccccgcaacctgcgcctgacctacctc
ctggagagccatggcgggcagctggccctggtactgtgcactgtggacagccgcccgccc
gcccagctggccctcagccacgccggtcgcctcttggcctcctcgacagcagcctctgtc
cccaacaccctgcgcctggagctgcgagggccacagcccagggatgagggtttctacagc
tgctctgcccgcagccctctgggccaggccaacacgtccctggagctgcggctggagggt
gtgcgggtgatcctggctccggaggctgccgtgcctgaaggtgcccccatcacagtgacc
tgtgcggaccctgctgcccacgcacccacactctatacttggtaccacaacggtcgttgg
ctgcaggagggtccagctgcctcactctcattcctggtggccacgcgggctcatgcaggc
gcctactcttgccaggcccaggatgcccagggcacccgcagctcccgtcctgctgccctg
caagtcctctatgcccctcaggacgctgtcctgtcctccttccgggactccagggccaga
tccatggctgtgatacagtgcactgtggacagtgagccacctgctgagctggccctatct
catgatggcaaggtgctggccacgagcagcggggtccacagcttggcatcagggacaggc
catgtccaggtggcccgaaacgccctacggctgcaggtgcaagatgtgcctgcaggtgat
gacacctatgtttgcacagcccaaaacttgctgggctcaatcagcaccatcgggcggttg
caggtagaaggtgcacgcgtggtggcagagcctggcctggacgtgcctgagggcgctgcc
ctgaacctcagctgccgcctcctgggtggccctgggcctgtgggcaactccacctttgca
tggttctggaatgaccggcggctgcacgcggagcctgtgcccactctcgccttcacccac
gtggctcgtgctcaagctgggatgtaccactgcctggctgagctccccactggggctgct
gcctctgctccagtcatgctccgtgtgctctaccctcccaagacgcccaccatgatggtc
ttcgtggagcctgagggtggcctccggggcatcctggattgccgagtggacagcgagccg
ctcgccagcctgactctccaccttggcagtcgactggtggcctccagtcagccccagggt
gctcctgcagagccacacatccatgtcctggcttcccccaatgccctgagggtggacatc
gaggcgctgaggcccagcgaccaaggggaatacatctgttctgcctcaaatgtcctgggc
tctgcctctacctccacctactttggggtcagagccctgcaccgcctgcatcagttccag
cagctgctctgggtcctgggactgctggtgggcctcctgctcctgctgttgggcctgggg
gcctgctacacctggagaaggaggcgtgtttgtaagcagagcatgggcgagaattcggtg
gagatggcttttcagaaagagaccacgcagctcattgatcctgatgcagccacatgtgag
acctcaacctgtgccccacccctgggctga

DBGET integrated database retrieval system