KEGG   Homo sapiens (human): 6622Help
Entry
6622              CDS       T01001                                 

Gene name
SNCA, NACP, PARK1, PARK4, PD1
Definition
synuclein, alpha (non A4 component of amyloid precursor)
Orthology
K04528  
synuclein, alpha (non A4 component of amyloid precursor)
Organism
hsa  Homo sapiens (human)
Pathway
Alzheimer's disease
Parkinson's disease
Disease
H00057  
Parkinson's disease (PD)
H00066  
Lewy body dementia (LBD)
Class
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:hsa05010]
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:hsa05012]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q21
AA seq 140 aa AA seqDB search
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP
DNEAYEMPSEEGYQDYEPEA
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggatgtattcatgaaaggactttcaaaggccaaggagggagttgtggctgctgctgag
aaaaccaaacagggtgtggcagaagcagcaggaaagacaaaagagggtgttctctatgta
ggctccaaaaccaaggagggagtggtgcatggtgtggcaacagtggctgagaagaccaaa
gagcaagtgacaaatgttggaggagcagtggtgacgggtgtgacagcagtagcccagaag
acagtggagggagcagggagcattgcagcagccactggctttgtcaaaaaggaccagttg
ggcaagaatgaagaaggagccccacaggaaggaattctggaagatatgcctgtggatcct
gacaatgaggcttatgaaatgccttctgaggaagggtatcaagactacgaacctgaagcc
taa

DBGET integrated database retrieval system